DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and AREL1

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001034568.1 Gene:AREL1 / 9870 HGNCID:20363 Length:823 Species:Homo sapiens


Alignment Length:576 Identity:164/576 - (28%)
Similarity:261/576 - (45%) Gaps:107/576 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 NTRKTTWQRPNSERLMHFQHWQGQRAHVVSQGNQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPD 481
            |...|.|..|.    ||                   :.|.|::..|||      |:||...|...
Human   306 NCSSTPWHLPP----MH-------------------MTSSQRRPSTAV------DEEDEDSPSEC 341

  Fly   482 GWEKKIQSDNRVY-FVNHKN--------RTTQWE------DPRTQGQEVS----------LINEG 521
            ...:|::...:|| :|:.|.        :...|.      .|.|:...:.          ::::|
Human   342 HTPEKVKKPKKVYCYVSPKQFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDG 406

  Fly   522 PLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQF-RYLC 585
            ..||         .|....:.|....||      .....|.:.|     ..:|:.|::.| |.|.
Human   407 IQPP---------VELSCKERNILAATF------IRSLHKNIGG-----SETFQDKVNFFQRELR 451

  Fly   586 QSNALPSHIKIT--VTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSH 648
            |.:....|.|:|  |:|..|.|.|..........:..:...::|:.||.||:||..||||.|:..
Human   452 QVHMKRPHSKVTLKVSRHALLESSLKATRNFSISDWSKNFEVVFQDEEALDWGGPRREWFELICK 516

  Fly   649 EVLNPMYCLFEYANKNNYSLQINPASYVNPD-----HLQYFKFIGRFIAMALY-------HGRFI 701
            .:.:....||...:.||.:| ::|    ||:     .|:.::|.||.:...||       :.:.:
Human   517 ALFDTTNQLFTRFSDNNQAL-VHP----NPNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLV 576

  Fly   702 YSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLI-WVKDNNIDECGLELWFSVD-FEVLGQIIH- 763
            .:.||..|..:::..::..|..||.|||||.|.: ::.:|::.|  :||.|:.: :...||:.. 
Human   577 RARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSE--MELVFAEEKYNKSGQLDKV 639

  Fly   764 HELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELIL 828
            .||...|.:..||..||..|:.|:.::|:...::::.:.||:|.||:||...|..|||.||||::
Human   640 VELMTGGAQTPVTNANKIFYLNLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLM 704

  Fly   829 CGMQDVDVEDWQRNTIY--RHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAEL 891
            ||..|:.|.|::.:.:.  ..::...|.:.|||..|.....|:.||||||.||:.::|.||||.|
Human   705 CGTGDISVSDFKAHAVVVGGSWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAAL 769

  Fly   892 MGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEE-TEGF 946
            ..|     |.|......:.||.:|||||:|.||.|.||:::...|..||.| .|||
Human   770 CPS-----FQIIAAPTHSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGF 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809 3/8 (38%)
WW 478..509 CDD:197736 7/45 (16%)
WW 522..554 CDD:197736 6/31 (19%)
HECTc 594..946 CDD:238033 123/371 (33%)
HECTc 620..946 CDD:214523 116/343 (34%)
AREL1NP_001034568.1 Filamin 52..158
Filamin 56..154 CDD:395505
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..345 12/58 (21%)
Interaction with SOCS2. /evidence=ECO:0000269|PubMed:31578312 483..789 100/317 (32%)
HECTc 486..820 CDD:214523 116/345 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.