DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Wwtr1

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001161753.1 Gene:Wwtr1 / 97064 MGIID:1917649 Length:452 Species:Mus musculus


Alignment Length:445 Identity:101/445 - (22%)
Similarity:148/445 - (33%) Gaps:121/445 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 GGVRARMRL-----------RSSSG-NSNGGETRSPLPNGGGDHRRSTQ---------------- 254
            ||. ||:||           |...| ..|......|||..|......||                
Mouse    32 GGC-ARLRLLCRLLAQWERPRPVPGIKMNPSSVPHPLPPPGQQVIHVTQDLDTDLEALFNSVMNP 95

  Fly   255 APPVWEQQQQQSQNQQQPLRMVNGSGAAVPQTAPYPQQP--------PAPALARPLTQVYGALPE 311
            .|..|.:            :::..|....|.:..:.:|.        |.|.||.....|    ..
Mouse    96 KPSSWRK------------KILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHV----RS 144

  Fly   312 NTQPAAVYLPAGGGAAVGPPGVAGPPIEQPGVGLPVSQSTDPQLQTQPADDE-PLPAGWEIRLDQ 375
            ::.||::.|..|.|||.|                |..|....:.|:....|| |||.|||:....
Mouse   145 HSSPASLQLGTGAGAAGG----------------PAQQHAHLRQQSYDVTDELPLPPGWEMTFTA 193

  Fly   376 YGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLMHFQHWQGQ 440
            .|:||:::|..:.|.|:.|         ||.....:.:|:.:...|:...|             |
Mouse   194 TGQRYFLNHIEKITTWQDP---------RKVMNQPLNHVNLHPSITSTSVP-------------Q 236

  Fly   441 RAHVVSQGNQRYLYSQQQQQPTAVTAQ--VTQDDEDALGPLPDGWEKKIQSD-----NRVYFVNH 498
            |:..|||.|....:..||...|:::.|  .||:....|..:|:....:.|..     .|:.....
Mouse   237 RSMAVSQPNLAMNHQHQQVVATSLSPQNHPTQNQPTGLMSVPNALTTQQQQQQKLRLQRIQMERE 301

  Fly   499 KNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDP-RPGAPKGAK- 561
            :.|..|.|..|   ||.:|..:  ||...|............|..:...:..|| ..|.|..:: 
Mouse   302 RIRMRQEELMR---QEAALCRQ--LPMETETMAPVNTPAMSTDMRSVTNSSSDPFLNGGPYHSRE 361

  Fly   562 ---------GVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVT-RQTLFED 606
                     |.|.||...| .|...:.:......|...|    :||. :||.|.|
Mouse   362 QSTDSGLGLGCYSVPTTPE-DFLSNMDEMDTGENSGQTP----MTVNPQQTRFPD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736 13/31 (42%)
WW 397..426 CDD:278809 4/28 (14%)
WW 478..509 CDD:197736 6/35 (17%)
WW 522..554 CDD:197736 6/32 (19%)
HECTc 594..946 CDD:238033 6/14 (43%)
HECTc 620..946 CDD:214523
Wwtr1NP_001161753.1 WW 182..213 CDD:197736 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.