DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and MAGI1

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001028229.1 Gene:MAGI1 / 9223 HGNCID:946 Length:1462 Species:Homo sapiens


Alignment Length:597 Identity:133/597 - (22%)
Similarity:201/597 - (33%) Gaps:220/597 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PTSSSGAGASGSANQG---YHQLSVTIEEASLRNNGFLKPNPYV---ELLIDSKSKRKTDLVKNS 90
            |....|....|.|..|   |......:|.|.|...|   ..|.:   |||::.:.      |:.|
Human    24 PQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGG---EGPRLGEGELLLEVQG------VRVS 79

  Fly    91 YLPKWNEEFTVLITPNSTLHFKVLDHSSFRKDAMLGERIINLAHILQHYNGRCE------FLELT 149
            .||:: :...|:.:....:.||.:     |:...|.:   :|.|.|   |.|.:      .|:.|
Human    80 GLPRY-DVLGVIDSCKEAVTFKAV-----RQGGRLNK---DLRHFL---NQRFQKGSPDHELQQT 132

  Fly   150 IDLFVTSKSDN----------RQTKSGEL-------VAILNGLKLDMSKLQIQPVAGQQNGN--- 194
            |       .||          |..:.||:       :.:...|.|:.|...::  .|...||   
Human   133 I-------RDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLE--VGTYEGNYYG 188

  Fly   195 ---PPVQAVNPSVVSDAAAGRSCMIYGGVRARMRLRSSSGNSNGGETRS--PLPNGGGDHRRSTQ 254
               ||.|.|:..|::             ..|...|:|.|..|....|:|  .:.|.|..|..:.:
Human   189 TPKPPSQPVSGKVIT-------------TDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEE 240

  Fly   255 APPVWEQ---------QQQQSQNQQQPLRMVNGSGAAVPQTAP---YPQQPPAPALARPLTQVYG 307
            ...|.|.         :|::...|:..|..||.|..|.|.|.|   :||                
Human   241 EDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQ---------------- 289

  Fly   308 ALPENTQPAAVYLPAGGGAAVGPPGVAGPPIEQPGVGLPVSQSTDPQLQTQPADDEPLPAGWEIR 372
                       |||......:|                                  |||..||:.
Human   290 -----------YLPLSAEDNLG----------------------------------PLPENWEMA 309

  Fly   373 LDQYGRRYYVDHNTRSTYW---------EKP------------------TPLPPGWEIRKDGRGR 410
            ..:.|..|::||||::|.|         :||                  ..||.|||..:|....
Human   310 YTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELELPAGWEKIEDPVYG 374

  Fly   411 VYYVDHNTRKTTWQRP--NSERLMHFQHWQGQRAHVVSQGNQRYLYSQQQQQPTAVTAQVTQDDE 473
            :|||||..|||.::.|  .::|....:..|.|      |..|:....|||||.|    :...:|.
Human   375 IYYVDHINRKTQYENPVLEAKRKKQLEQQQQQ------QQQQQQQQQQQQQQQT----EEWTEDH 429

  Fly   474 DALGP--LPD--------GWEKKIQ---------SDNRVYFVNHKNRTTQ---------WEDPRT 510
            .||.|  :|:        ..|..:|         |:.:..|::.|.|.:.         .::|..
Human   430 SALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDE 494

  Fly   511 QGQEVSLINEGP 522
            ..|..||:.:||
Human   495 FLQIKSLVLDGP 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988 31/150 (21%)
WW 364..396 CDD:197736 15/58 (26%)
WW 397..426 CDD:278809 14/28 (50%)
WW 478..509 CDD:197736 8/58 (14%)
WW 522..554 CDD:197736 1/1 (100%)
HECTc 594..946 CDD:238033
HECTc 620..946 CDD:214523
MAGI1NP_001028229.1 PDZ_signaling 15..100 CDD:238492 19/85 (22%)
GuKc 122..293 CDD:214504 45/219 (21%)
WW 303..332 CDD:238122 11/28 (39%)
WW 361..390 CDD:278809 14/28 (50%)
PDZ 469..555 CDD:214570 9/38 (24%)
PDZ 640..723 CDD:214570
MAGI_u5 722..805 CDD:293271
PDZ_signaling 819..894 CDD:238492
PDZ_signaling 968..1062 CDD:238492
PDZ 1123..1205 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.