DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and UBE3B

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_569733.2 Gene:UBE3B / 89910 HGNCID:13478 Length:1068 Species:Homo sapiens


Alignment Length:399 Identity:123/399 - (30%)
Similarity:200/399 - (50%) Gaps:46/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 SNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRG-----EEGLDYGGVSREWFFLL 646
            |:|.|....||:.|..:.||.|.|:.:|..:.::..:.:.|..     |.|:|..||.:|:...:
Human   674 SSASPHVTHITIRRSRMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGVDEAGIDQDGVFKEFLEEI 738

  Fly   647 SHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYK 711
            ...|.:|...||: ....:..|..:|.||::.::||.|:|:|:.:..|:|.|..:    .:||..
Human   739 IKRVFDPALNLFK-TTSGDERLYPSPTSYIHENYLQLFEFVGKMLGKAVYEGIVV----DVPFAS 798

  Fly   712 RMLNKKL---------TIKDIETIDPEFYNSLIWVK--DNNIDECGLELWFSVDFEVLGQIIHHE 765
            ..|::.|         ::.::.::|.|||.:|..:|  |.:|.:.||.|  |.|.:|:||::.||
Human   799 FFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTL--SYDEDVMGQLVCHE 861

  Fly   766 LKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCG 830
            |...|:...||.|||..||.||..:||...|:.||...:.||..::..||::.|...||:.::.|
Human   862 LIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISG 926

  Fly   831 -MQDVDVEDWQRNTI-YRHYNRNSKQVVWFWQFV-RETDNEKRARLLQFVTGTCRVPVGGFAEL- 891
             ..::|:||.:::|: |..::.:.:.::|.|..: .:...::||..|:|||...|.|:.|||.| 
Human   927 DNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPDERAMFLKFVTSCSRPPLLGFAYLK 991

  Fly   892 -------------------MGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLT 937
                               :||.....|.|.|......||.|.||||.|.||.|.....|.|||.
Human   992 PPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREKLR 1056

  Fly   938 FAIEETEGF 946
            :||....||
Human  1057 YAISMNTGF 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 118/390 (30%)
HECTc 620..946 CDD:214523 110/364 (30%)
UBE3BNP_569733.2 HECTc 682..1066 CDD:238033 120/391 (31%)
HECTc 707..1065 CDD:214523 110/364 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.