DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and UPL5

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_192994.1 Gene:UPL5 / 826870 AraportID:AT4G12570 Length:873 Species:Arabidopsis thaliana


Alignment Length:368 Identity:105/368 - (28%)
Similarity:179/368 - (48%) Gaps:35/368 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 KITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFE 659
            ::.:.|..|..:|:..|:......|...|::.|:.||... .||.||||:|:..|:.||...||.
plant   512 EMLIDRSNLLSESFEYIVGASPEALHGGLFMEFKNEEATG-PGVLREWFYLVCQEIFNPKNTLFL 575

  Fly   660 YANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIE 724
            .:..:......||||.|:|.|..:|:|.||.||:||.|...:...|...|:.::...|::::||:
plant   576 RSADDFRRFSPNPASKVDPLHPDFFEFTGRVIALALMHKVQVGVLFDRVFFLQLAGLKISLEDIK 640

  Fly   725 --------------TIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERV 775
                          .:||||::|          ..||.|.|.::.|.||:....||..:|:.:.|
plant   641 DTDRIMYNSCKQILEMDPEFFDS----------NAGLGLTFVLETEELGKRDTIELCPDGKLKAV 695

  Fly   776 TEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNE-----VVPLEWLKYFDERELELILCGMQD-V 834
            ..:|:::|:.|:.|.|....|.:|.|.|..||.:     |.|..:.|.....:|:.:|.|.:: :
plant   696 NSKNRKQYVDLLIERRFATPILEQVKQFSRGFTDMLSHSVPPRSFFKRLYLEDLDGMLRGGENPI 760

  Fly   835 DVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQR 899
            .::||:.:|.|..:....:|:.|||:.:::...|::..:|.|.|....|||.||..|    ..:.
plant   761 SIDDWKAHTEYNGFKETDRQIDWFWKILKKMTEEEQRSILFFWTSNKFVPVEGFRGL----SSKL 821

  Fly   900 FCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEE 942
            :..........||.|||||.||.:|.|.:...:.::|....::
plant   822 YIYRLYEANDRLPLSHTCFYRLCIPRYPTITLMEQRLRLIAQD 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 105/368 (29%)
HECTc 620..946 CDD:214523 100/343 (29%)
UPL5NP_192994.1 UBQ 95..167 CDD:214563
ubiquitin 102..168 CDD:278661
HECTc 511..871 CDD:238033 105/368 (29%)
HECTc 540..860 CDD:214523 100/334 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11254
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X898
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.