DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Ube3b

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001137366.1 Gene:Ube3b / 687633 RGDID:1583074 Length:1070 Species:Rattus norvegicus


Alignment Length:396 Identity:126/396 - (31%)
Similarity:199/396 - (50%) Gaps:40/396 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 SNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRG-----EEGLDYGGVSREWFFLL 646
            |:|.|....||:.|..:.||.|.|:.:||.:.::..:.:.|..     |.|:|..||.:|:...:
  Rat   676 SSASPHVTHITIRRSRMLEDGYEQLRQLPQHAMKGAIRVKFVSDLGVDEAGIDQDGVFKEFLEEI 740

  Fly   647 SHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYK 711
            ...|.:|...||: ....:..|..:|.||::.::||.|:|:|:.:..|:|.|..:...|...|..
  Rat   741 IKRVFDPALNLFK-TTSGDERLYPSPTSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLS 804

  Fly   712 RMLNKK-----LTIKDIETIDPEFYNSLIWVK--DNNIDECGLELWFSVDFEVLGQIIHHELKEN 769
            :||...     .::.::.::|.|||.:|..:|  |.::.:.||.|  |.|.:|:||::.|||...
  Rat   805 QMLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDVADLGLTL--SYDEDVMGQLVCHELVPG 867

  Fly   770 GEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCG-MQD 833
            |:...||:|||..||.||..:||...|:.||...:.||..::..||::.|...||:.::.| ..:
  Rat   868 GKTIPVTDENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGDNAE 932

  Fly   834 VDVEDWQRNTI-YRHYNRNSKQVVWFWQFVRE--TDNEKRARLLQFVTGTCRVPVGGFAEL---- 891
            :|:||.:::|: |..::.:.:.:||.|..:..  |..| ||..|:|||...|.|:.|||.|    
  Rat   933 IDLEDLKKHTVYYGGFHGSHRVIVWLWDILASDFTPGE-RAMFLKFVTSCSRPPLLGFAYLKPPF 996

  Fly   892 ----------------MGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAI 940
                            :||.....|.|.|......||.|.||||.|.||.|.....|.|||.:||
  Rat   997 SIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREKLRYAI 1061

  Fly   941 EETEGF 946
            ....||
  Rat  1062 SMNTGF 1067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 121/387 (31%)
HECTc 620..946 CDD:214523 112/361 (31%)
Ube3bNP_001137366.1 HECTc 684..1068 CDD:238033 123/388 (32%)
HECTc 709..1067 CDD:214523 112/361 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.