DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and hectd2

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_009304826.1 Gene:hectd2 / 562999 ZFINID:ZDB-GENE-100405-3 Length:756 Species:Danio rerio


Alignment Length:370 Identity:121/370 - (32%)
Similarity:188/370 - (50%) Gaps:30/370 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 IKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLF 658
            :.|.|.|..|..||..::.|..| :|:::|.:.|.||.|||.||:::|||.||..::.:..|.:|
Zfish   397 LNIKVRRLQLVSDSLDELSRKRA-DLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHTDYGMF 460

  Fly   659 EYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLN-------- 715
            .|..::    |....|....|:...|:.:|..:.:|:|:...:...|....||::|.        
Zfish   461 TYVKES----QCYWFSSWKCDNYSEFRLVGALMGLAVYNSITLDIRFPPCVYKKLLTPPIVPCDL 521

  Fly   716 ------KKLTIKDIETIDPEFYNSL--IWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEK 772
                  ..||:.|::.|.|:..:.|  :...:.|::| .....|.|..|.||.:..:.||..|:|
Zfish   522 DTPVGMATLTLDDLQQIMPDLAHGLGELLSYEGNVEE-DFYTTFQVFQEELGVVKAYNLKPGGDK 585

  Fly   773 ERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVE 837
            ..||..|::||:.|..::.:.:.|.:|...|..||:.|.....|......|:|:::||..::|:.
Zfish   586 IPVTNLNRKEYVQLYIDFLLNKSIYRQFAAFYHGFHSVCASNALMLLRPEEVEILVCGSPNLDMG 650

  Fly   838 DWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCI 902
            ..||...|..|::....:..||..|.....|.:.:||.|.||:.||||||.|:|       .|.|
Zfish   651 SLQRVVQYEGYSKTDPTIRAFWDVVLAFPLELQKKLLHFTTGSDRVPVGGMADL-------NFKI 708

  Fly   903 EKVGKET-WLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
            .|:...| |||.||||||::.||||||..:|.:|||.||...|||
Zfish   709 SKIDVSTDWLPVSHTCFNQICLPPYKSKKELRQKLTIAISNAEGF 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 119/368 (32%)
HECTc 620..946 CDD:214523 110/342 (32%)
hectd2XP_009304826.1 HECTc 397..754 CDD:238033 121/370 (33%)
HECTc 420..753 CDD:214523 111/344 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.