DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and HERC6

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:358 Identity:94/358 - (26%)
Similarity:166/358 - (46%) Gaps:24/358 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 ITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEY 660
            :.|.|..|.:|:..|:.:..|.:..:.|.:.|..|...:.||||.|:|..:..|:..|.|.:|.|
Human   686 LRVRRSRLVKDALRQLSQAEATDFCKVLVVEFINEICPESGGVSSEFFHCMFEEMTKPEYGMFMY 750

  Fly   661 ANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIET 725
            ....  |....||. ..|:..:||.| |....::|::.......|.:..||::|::|.:::|::.
Human   751 PEMG--SCMWFPAK-PKPEKKRYFLF-GMLCGLSLFNLNVANLPFPLALYKKLLDQKPSLEDLKE 811

  Fly   726 IDPEFYNSLIWVKDNNIDECG--LELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMT 788
            :.|....||..|.|:..|:.|  |.:.||:.::....    :|..||....|.:.||.:|::...
Human   812 LSPRLGKSLQEVLDDAADDIGDALCIRFSIHWDQNDV----DLIPNGISIPVDQTNKRDYVSKYI 872

  Fly   789 EWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRH-YNRNS 852
            ::.....::...:.|..||..|...|.|::|...||...:.|..|.|.:.:::|:.|.. |.::.
Human   873 DYIFNVSVKAVYEEFQRGFYRVCEKEILRHFYPEELMTAIIGNTDYDWKQFEQNSKYEQGYQKSH 937

  Fly   853 KQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSH-- 915
            ..:..||:...:...:::.:.|.|:||..|         :.:.|.|:..|.....||:..|.|  
Human   938 PTIQLFWKAFHKLTLDEKKKFLFFLTGRDR---------LHARGIQKMEIVFRCPETFSERDHPT 993

  Fly   916 --TCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
              ||.|.|.||.|.:.:::.|.|..||....||
Human   994 SITCHNILSLPKYSTMERMEEALQVAINNNRGF 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 92/356 (26%)
HECTc 620..946 CDD:214523 86/332 (26%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274
RCC1_2 89..118 CDD:290274
RCC1 105..155 CDD:278826
RCC1 158..208 CDD:278826
RCC1 215..263 CDD:278826
RCC1_2 250..279 CDD:290274
RCC1 266..313 CDD:278826
HECTc 684..1026 CDD:238033 92/356 (26%)
HECTc 711..1026 CDD:214523 86/331 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.