DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Su(dx) and Wwc2

DIOPT Version :9

Sequence 1:	NP_001259898.1	Gene:	Su(dx) / 33379	FlyBaseID:	FBgn0003557	Length:	949	Species:	Drosophila melanogaster
Sequence 2:	NP_598552.2	Gene:	Wwc2 / 52357	MGIID:	1261872	Length:	1187	Species:	Mus musculus

Alignment Length:	128	Identity:	40/128 - (31%)
Similarity:	59/128 - (46%)	Gaps:	39/128 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   396 PLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLMHFQHWQGQRAHVVSQGNQRYLYSQQQQQ 460
            |||.|||..:|..|:|:|:|||||:|:|..|. :||                           .:
Mouse    11 PLPRGWEEARDYDGKVFYIDHNTRRTSWIDPR-DRL---------------------------TK 47

  Fly   461 PTAVTAQVTQDDEDALG-PLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQ--GQEVSLINE 520
            |.:..        |.:| .||.|||.........|:::|.|:|||.||||.|  |::..::.:
Mouse    48 PLSFA--------DCVGDELPWGWEAGFDPQIGAYYIDHINKTTQIEDPRKQWRGEQEKMLKD 102

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Su(dx)	NP_001259898.1	C2_E3_ubiquitin_ligase	48..173	CDD:175988
		WW	364..396	CDD:197736	40/128 (31%)
		WW	397..426	CDD:278809	16/28 (57%)
		WW	478..509	CDD:197736	13/30 (43%)
		WW	522..554	CDD:197736
		HECTc	594..946	CDD:238033
		HECTc	620..946	CDD:214523
Wwc2	NP_598552.2	WW	12..41	CDD:278809	16/28 (57%)
		WW	59..88	CDD:278809	12/28 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	438..464
		C2_Kibra	699..822	CDD:176062
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	830..849
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	874..963
		Phage_Nu1	<1088..>1146	CDD:294991
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900