DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and bag3

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001003533.1 Gene:bag3 / 445139 ZFINID:ZDB-GENE-040801-40 Length:459 Species:Danio rerio


Alignment Length:332 Identity:65/332 - (19%)
Similarity:108/332 - (32%) Gaps:134/332 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 ADDEPLPAGWEIRLD-QYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKT-- 421
            |.::|||.||||::| |.|..::||||.|:|.|..|.                    |:|:|.  
Zfish     2 ATNDPLPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPR--------------------HDTKKIFS 46

  Fly   422 --TWQRPNSERLMHFQHWQGQRAHVVSQG-------------------NQRYLYSQQQQ------ 459
              ....|.:.:.||.......|..::.||                   :..|::...||      
Zfish    47 NGPSMSPETPQDMHKTFINEMRQPMLRQGYIPIPVCHENPEPRLQQYPSFSYIHPAVQQNLRTDG 111

  Fly   460 ---QPTAVT-------AQVTQDDEDALGPL---PDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQ 511
               .||...       .|...:...:..|.   |:|::                       |:..
Zfish   112 RTPSPTPAAHCRPRSPVQTPSEACSSCSPTSHGPEGYQ-----------------------PQGT 153

  Fly   512 GQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERS--- 573
            .|::|.:::.|......:|   ||   ::           |.|...:||.||  :|....:|   
Zfish   154 HQQISGLHQQPRSSNTGLR---AG---YI-----------PIPVIHEGAGGV--LPSQLSQSSHP 199

  Fly   574 FRWKL--SQFRYLCQSNALPSHIKITVTRQ------------------------TLFEDSYHQIM 612
            .|.|:  .|.....|.|...|.|::.:..|                        :..|....:|:
Zfish   200 TREKIYREQVPIQIQQNRAASPIQVPLRAQSPVMAQIMGERPQMQQHIGHTAIPSKIEHPVEEII 264

  Fly   613 RLPAYEL 619
            |:|.:|:
Zfish   265 RVPTFEV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736 18/32 (56%)
WW 397..426 CDD:278809 3/32 (9%)
WW 478..509 CDD:197736 3/33 (9%)
WW 522..554 CDD:197736 5/31 (16%)
HECTc 594..946 CDD:238033 7/50 (14%)
HECTc 620..946 CDD:214523 65/332 (20%)
bag3NP_001003533.1 WW 6..38 CDD:197736 17/31 (55%)
BAG 358..432 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.