DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and ube3c

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_956767.2 Gene:ube3c / 393445 ZFINID:ZDB-GENE-040426-1211 Length:1081 Species:Danio rerio


Alignment Length:371 Identity:111/371 - (29%)
Similarity:188/371 - (50%) Gaps:31/371 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 IKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRG-----EEGLDYGGVSREWFFLLSHEVLNP 653
            :.:|:.|..::||:|.::......:|::|:.:....     |.|:|.||:.||:...|.....||
Zfish   721 VNVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNP 785

  Fly   654 MYCLFEYANKNNYSLQINPAS--YVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNK 716
            ....|:..|:.  .|..:|.:  .|.....:::.|:||.:..|||....:    .:||....|:|
Zfish   786 NQGFFKTTNEG--LLYPSPTAEMLVGESFTRHYYFLGRILGKALYENMLV----ELPFASFFLSK 844

  Fly   717 KL-TIKDIE-----TIDPEFYNSLIWVK--DNNIDECGLELWFSVDFEVLGQIIHHELKENGEKE 773
            .| |..|::     ::|||.|.:|:::|  :.::::.||.  |:|....||:....|||..|:..
Zfish   845 LLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEDLGLN--FTVVNNDLGEAQVVELKPGGKDI 907

  Fly   774 RVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQ-DVDVE 837
            .||..|:..||.|:.::|:.:.|......|.:|...||.||||:.||::|:::::.|.. .:.:|
Zfish   908 PVTTANRIAYIHLVADYRLNKQIRAHCLAFRQGLANVVNLEWLRMFDQQEIQVLVSGAHVPICLE 972

  Fly   838 DWQRNTIYR-HYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFC 901
            |.:|.|.|. .|:.....:..||..|....:|::.:||:|||...|.|:.||.||..:     ||
Zfish   973 DLKRFTNYSGGYSATHPVIKIFWDVVESFSDEEKRKLLKFVTSCSRPPLLGFKELYPA-----FC 1032

  Fly   902 IEKVGKE-TWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
            |...|.: ..||.:.||.|.|.||.:.....:..||.:|||.:.||
Zfish  1033 IHNGGTDLERLPTASTCMNLLKLPEFCDPQLMRNKLLYAIESSAGF 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 109/369 (30%)
HECTc 620..946 CDD:214523 103/343 (30%)
ube3cNP_956767.2 IQ 47..64 CDD:197470
HECTc 723..1079 CDD:238033 111/369 (30%)
HECTc 745..1078 CDD:214523 104/345 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.