DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Herc4

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:387 Identity:116/387 - (29%)
Similarity:191/387 - (49%) Gaps:38/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 YGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFR 628
            ||:|          :|||            |.:.|||:.|.:||..::......:|::.|.|.|.
  Fly   707 YGMP----------ISQF------------IVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKFH 749

  Fly   629 GEEGLDYGGVSREWFFLLSHEVLNPMYCLF-EYANKNNYSLQINPASYVNPDHLQYFKFIGRFIA 692
            |||..|.|||.:|:|.||..::|:|.|.:| ||  :.:..|.....::...:  .|| .||....
  Fly   750 GEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEY--EQSRLLWFADLTFETEN--MYF-LIGVLCG 809

  Fly   693 MALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECG--LELWFSVDF 755
            :|:|:...|...|.:..:|::|.|.:.:.|:..:.|...||:..:.|...|:..  .:|.|.:..
  Fly   810 LAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISR 874

  Fly   756 EVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFD 820
            :|.|:.....||.||.:..||.||::|::.|..::...:.:|.....|.:||.:|.....:..|.
  Fly   875 DVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQ 939

  Fly   821 ERELELILCGMQDVDVEDWQRNTIYRH-YNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVP 884
            ..||..::.|.:|.|.:..|.|..||. |......:.|||:.:.:....::...|.|:||:.|:|
  Fly   940 PEELMAVVVGNEDYDWQALQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIP 1004

  Fly   885 VGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
            :.|...|       :..|:....|.:||.:|||||.||||.||:.::|..||..||::|:||
  Fly  1005 IQGMKAL-------KLTIQPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 108/355 (30%)
HECTc 620..946 CDD:214523 100/329 (30%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 110/357 (31%)
HECTc 739..1059 CDD:214523 101/331 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.