DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and CG3356

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:433 Identity:125/433 - (28%)
Similarity:209/433 - (48%) Gaps:44/433 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 RRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIK-------------- 595
            |..|.||...|.|...|.:..:....|..|....::...:.||....|.::              
  Fly   700 RDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQSLVAASKMRVQGNMQAFLQGPSV 764

  Fly   596 -ITVTRQTLFEDSYHQIMRLPAYELRRRLYIIF-----RGEEGLDYGGVSREWFFLLSHEVLNPM 654
             |||.|..|:||:|.::......:||.:..|.|     ..|.|:|.|||.||:...|.....:| 
  Fly   765 LITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDP- 828

  Fly   655 YCLFEYANKNNYSLQINPASYVNP-------DHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKR 712
                   |:..:.:..:...|.||       |:.:::.||||.:..::|....:.......|..:
  Fly   829 -------NRGFFMVTTDNKLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTK 886

  Fly   713 MLNK--KLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERV 775
            :..|  .:.|..:.::|||.|.:|:::||.:.|...|.|.|:|....|||....|||..|:...|
  Fly   887 LAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPV 951

  Fly   776 TEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQ-DVDVEDW 839
            |..|:.||:.|:.::::...|.:....|.:|.:.|:|:|||..|..:||::::.|.: .:|:||.
  Fly   952 TNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDL 1016

  Fly   840 QRNTIY-RHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIE 903
            :::..| ..::.....:|.||:.:...|:.:|.:||:|||...|.|:.||.:|   :.|  |.|:
  Fly  1017 KKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL---DPP--FFIQ 1076

  Fly   904 KVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
            ..|....||.:.||.|.|.|||:|:.:|:.|||.:||:...||
  Fly  1077 NTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736 4/8 (50%)
HECTc 594..946 CDD:238033 111/382 (29%)
HECTc 620..946 CDD:214523 102/341 (30%)
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 113/367 (31%)
HECTc 788..1119 CDD:214523 103/343 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.