DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Herc3

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001102101.1 Gene:Herc3 / 362377 RGDID:1307803 Length:1050 Species:Rattus norvegicus


Alignment Length:370 Identity:112/370 - (30%)
Similarity:191/370 - (51%) Gaps:25/370 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 LCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSH 648
            |.:|..|..|::    |..|..|:..::......:|::.|.:||.||||:|.|||::|:|.||..
  Rat   696 LARSPFLVLHVR----RNHLVGDALRELSIHSDIDLKKPLKVIFDGEEGVDAGGVTKEFFLLLLK 756

  Fly   649 EVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRM 713
            |:|||:|.:|.|...:|. |..:...:|  :| .:|..||....:|:|:...:...|.:..||::
  Rat   757 ELLNPIYGMFTYYQDSNL-LWFSDTCFV--EH-NWFHLIGITCGLAIYNSTVVDLHFPLALYKKL 817

  Fly   714 LNKKLTIKDIETIDPEFYNSLIWVKD---NNIDE--CGLELWFSVDFEVLGQIIHHELKENGEKE 773
            ||.|.:::|::.:.|....||..:.|   .:|:|  |   |.|:|..|..|.|...:|...|::.
  Rat   818 LNVKPSLEDLKELSPTEGRSLQELLDYPGEDIEETFC---LNFTVCRESYGVIEQKKLIPGGDRV 879

  Fly   774 RVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVED 838
            .|.::|::|::.....:.....:.:....|..||.:|...:.|:.|...||..::.|..:.:.|:
  Rat   880 AVCKDNRQEFVDAYVNYIFQISVHEWYTAFSSGFLKVCGGKVLELFQPAELRAMMVGNSNYNWEE 944

  Fly   839 WQRNTIYR-HYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCI 902
            .:...:|: .|:.....|..||:...|...||:.|.|.|:||:.|:|:.|.|.|       :..|
  Rat   945 LEETAVYKGDYSSTHPTVKLFWETFHEFPLEKKKRFLLFLTGSDRIPIYGMASL-------QIVI 1002

  Fly   903 EKVGK-ETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
            :.... |.:||.:|||:|.||||.|.|.:.:..:||.|::..|||
  Rat  1003 QSTATGEDYLPVAHTCYNLLDLPKYSSKEIMKARLTQALDNYEGF 1047

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 106/358 (30%)
HECTc 620..946 CDD:214523 102/332 (31%)
Herc3NP_001102101.1 ATS1 2..331 CDD:227511
RCC1 313..377 CDD:395335
HECTc 702..1048 CDD:238033 110/364 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.