DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Ube3c

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_038964472.1 Gene:Ube3c / 362294 RGDID:1559986 Length:1083 Species:Rattus norvegicus


Alignment Length:373 Identity:121/373 - (32%)
Similarity:195/373 - (52%) Gaps:35/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 IKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRG-----EEGLDYGGVSREWFFLLSHEVLNP 653
            |.:|:.|..::||:|.::......:|::|:.:....     |.|:|.||:.||:...|.....||
  Rat   723 INVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNP 787

  Fly   654 MYCLFEYANKNNYSLQINPAS--YVNPDHLQYFKFIGRFIAMALYHGRFI---YSGFTMPFYKRM 713
            ....|:..|:.  .|..|||:  .|.....:::.|:||.:..|||....:   ::||   |..::
  Rat   788 NQGFFKTTNEG--LLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGF---FLSKL 847

  Fly   714 L--NKKLTIKDIETIDPEFYNSLIWVK--DNNIDECGLELWFSVDFEVLGQIIHHELKENGEKER 774
            |  :..:.|..:.::|||.|.:|:::|  :.:::|.||.  |:|....||:....|||..|:...
  Rat   848 LGTSADVDIHHLASLDPEVYKNLLFLKSYEEDVEELGLN--FTVVNNDLGEAQVVELKFGGKDIP 910

  Fly   775 VTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQ-DVDVED 838
            ||..|:..||.|:.::|:.:.|......|.:|...||.||||:.||::|:::::.|.| .|.:||
  Rat   911 VTGANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLED 975

  Fly   839 WQRNTIYR-HYNRNSKQVVWFWQFVRE-TDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFC 901
            .:..|.|. .|:.:...:..||:.|.. ||.||| :||:|||...|.|:.||.||..:     ||
  Rat   976 LKSFTNYSGGYSADHPVIKIFWRVVEGFTDEEKR-KLLKFVTSCSRPPLLGFKELYPA-----FC 1034

  Fly   902 IEKVGKE-TWLPRSHTCFNRLDLPPYKSYDQ--LVEKLTFAIEETEGF 946
            |...|.: ..||.:.||.|.|.||.:  ||:  |..||.:|||...||
  Rat  1035 IHNGGSDLERLPTASTCMNLLKLPEF--YDEALLRSKLLYAIECAAGF 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 119/371 (32%)
HECTc 620..946 CDD:214523 112/345 (32%)
Ube3cXP_038964472.1 IQ 47..64 CDD:197470
HECTc 725..1081 CDD:238033 120/371 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.