DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and HERC2

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster


Alignment Length:366 Identity:92/366 - (25%)
Similarity:166/366 - (45%) Gaps:53/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 IMRLP-----AYELRRRLY-IIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLF---------EY 660
            :.:||     |..|..|:: :.|.||...|.||...|....:..|:.|....|.         ..
  Fly  4537 VQKLPLLTQEALALPHRVWKVKFVGESVDDCGGGYSESIAEMCDELQNGSVPLLINTPNGRGEAG 4601

  Fly   661 ANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIET 725
            ||::.:.|....:|.:   .:..|:|:|..:.:|:..|..:......|.::::..:.|...|:..
  Fly  4602 ANRDCFLLDPTLSSVL---QMNMFRFLGVLMGIAVRTGSPLSINLAEPVWRQLTGEVLRPTDLTE 4663

  Fly   726 IDPEFYNSLIWVKDNNIDE-----CGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYIT 785
            :|.::...|:.::  |:|:     ..|||.||.. ...|    ||:..:.....::..|:.||:.
  Fly  4664 VDRDYVAGLLCIR--NMDDDPKLFTALELPFSTS-SARG----HEVPLSTRYTHISPRNRAEYVR 4721

  Fly   786 LMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNR 850
            |...:|: ...::|.|...:|.::|:|:..|..|...||:.::||..|:.:...:....|:.::.
  Fly  4722 LALGFRL-HEFDEQVKAVRDGMSKVIPVPLLSLFSAAELQAMVCGSPDIPLGLLKSVATYKGFDP 4785

  Fly   851 NSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVP--VGGF------AELMGSNGPQRFCIEKVGK 907
            :|..|.|||:.:.|..|::|:..|:||.|..|:|  :..|      .:::..|.|..|       
  Fly  4786 SSALVTWFWEVMEEFTNQERSLFLRFVWGRTRLPRTIADFRGRDFVLQVLEKNPPDHF------- 4843

  Fly   908 ETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQ 948
               ||.|:|||..|.:|.|.....|:|||.:||.    ||:
  Fly  4844 ---LPESYTCFFLLKMPRYSCKAVLLEKLKYAIH----FCK 4877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 90/362 (25%)
HECTc 620..946 CDD:214523 86/348 (25%)
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033 92/366 (25%)
HECTc 4553..4878 CDD:214523 88/350 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446992
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.