DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Bag3

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:297 Identity:63/297 - (21%)
Similarity:108/297 - (36%) Gaps:83/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 ADDEPLPAGWEIRLD-QYGRRYYVDHNTRSTYWEKPTPLPPGWE--------IRKDG-------R 408
            :|.:|||.||||::| |.|..::||||:|:|.|..|...|.|.:        ..:||       .
  Rat    19 SDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKETASSANGPSRDGSRLLPARE 83

  Fly   409 GRVYYVDHNTRKTTWQRPNSERL-MHFQHWQGQRAHVVSQGNQRYLYSQQ--QQQPTAVTAQVTQ 470
            |...|..        .||....: :|.:..:.::.|:.      :.|||.  |:..|...|...|
  Rat    84 GHPIYPQ--------LRPGYIPIPVHHEGSENRQPHLF------HAYSQPGVQRFRTEAAAAAPQ 134

  Fly   471 DDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAG 535
            ..:   .||..|..:..|:|.:   ..........:.|...|.|.|   :.|.........::|.
  Rat   135 RSQ---SPLRGGVTETTQTDKQ---CGQVPAAATAQPPTAHGPERS---QSPAASDCSSSSSSAS 190

  Fly   536 ERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTR 600
                             .|.:.:.:.|.:.:||.|                 ..:|...:..:||
  Rat   191 -----------------LPSSGRSSLGSHQLPRGY-----------------IPIPVIHEQNITR 221

  Fly   601 QTLFEDSYHQIMR--LPA----YELRRRLYIIFRGEE 631
            ... :.|:||..:  .||    |:.::.:|...:|::
  Rat   222 PAA-QPSFHQAQKTHYPAQQGEYQPQQPVYHKIQGDD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736 18/32 (56%)
WW 397..426 CDD:278809 6/43 (14%)
WW 478..509 CDD:197736 5/30 (17%)
WW 522..554 CDD:197736 2/31 (6%)
HECTc 594..946 CDD:238033 10/44 (23%)
HECTc 620..946 CDD:214523 2/12 (17%)
Bag3NP_001011936.1 WW 23..55 CDD:197736 17/31 (55%)
BAG 423..500 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.