DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and HERC4

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:458 Identity:119/458 - (25%)
Similarity:217/458 - (47%) Gaps:35/458 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 VNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGA 560
            ::.:|....|...:..|.:|   |.| |....:|..|.....|..|...:.|..:         .
Human   649 IDIRNDYINWVQQQAYGMDV---NHG-LTELADIPVTICTYPFVFDAQAKTTLLQ---------T 700

  Fly   561 KGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYI 625
            ..|..:..|.:::.|..:|.. :|....::...:.:.|.|:.:..|:...:.:....:.::.|.:
Human   701 DAVLQMQMAIDQAHRQNVSSL-FLPVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKV 764

  Fly   626 IFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRF 690
            ||.||:.:|.|||.:|:|.|:..|:|:|.|.:|.| .:::..:..:..::.:.|   .|..||..
Human   765 IFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRY-YEDSRLIWFSDKTFEDSD---LFHLIGVI 825

  Fly   691 IAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNS---LIWVKDNNIDE--CGLELW 750
            ..:|:|:...:...|.:..||::|.||.::.|::.:.|:...|   |:...:::|:|  |   |.
Human   826 CGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPEDDIEETFC---LN 887

  Fly   751 FSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEW 815
            |::..|..|.....||..||....|.::|::|::....::...:.:......|..||::|...:.
Human   888 FTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKV 952

  Fly   816 LKYFDERELELILCGMQDVDVEDWQRNTIYR-HYNRNSKQVVWFWQFVRETDNEKRARLLQFVTG 879
            |..|...||:.::.|..:.|.::.::||.|: .|......:..||:...|...||:.:.|.|:||
Human   953 LLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTG 1017

  Fly   880 TCRVPVGGFAELMGSNGPQRFCIEKV-GKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEET 943
            :.|:|:.|...|       :..|:.. |.|.:||.||||||.||||.|...:.|..||..||:..
Human  1018 SDRIPILGMKSL-------KLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHN 1075

  Fly   944 EGF 946
            |||
Human  1076 EGF 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736 2/12 (17%)
WW 522..554 CDD:197736 6/31 (19%)
HECTc 594..946 CDD:238033 100/358 (28%)
HECTc 620..946 CDD:214523 97/332 (29%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 102/360 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.