DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and WWC1

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_011532787.1 Gene:WWC1 / 23286 HGNCID:29435 Length:1185 Species:Homo sapiens


Alignment Length:161 Identity:46/161 - (28%)
Similarity:73/161 - (45%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 PLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQE----VSLINEGPLPPGWEIRYTAAGERF 538
            |||:|||:....|.:||:::|.||||.|.|||.:..:    ...|:: .||.|||..|......:
Human     7 PLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISD-ELPLGWEEAYDPQVGDY 70

  Fly   539 FVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYL-----CQSNALPSHIKITV 598
            |:||||:.|..||||                    .:|:..|...|     ....||.:..:|..
Human    71 FIDHNTKTTQIEDPR--------------------VQWRREQEHMLKDYLVVAQEALSAQKEIYQ 115

  Fly   599 TRQ---TLFEDSYHQIMRLPAYELRRRLYII 626
            .:|   .|.:..|.|:..:..::|..::.::
Human   116 VKQQRLELAQQEYQQLHAVWEHKLGSQVSLV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736 16/30 (53%)
WW 522..554 CDD:197736 15/31 (48%)
HECTc 594..946 CDD:238033 6/36 (17%)
HECTc 620..946 CDD:214523 0/7 (0%)
WWC1XP_011532787.1 WW 9..39 CDD:238122 15/29 (52%)
WW 55..84 CDD:278809 13/28 (46%)
ALDH-SF 429..>481 CDD:299846
C2_Kibra 721..844 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.