DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and Yap1

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_006509915.1 Gene:Yap1 / 22601 MGIID:103262 Length:494 Species:Mus musculus


Alignment Length:572 Identity:123/572 - (21%)
Similarity:189/572 - (33%) Gaps:198/572 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 APPVWEQQQQQSQNQQQPLR-----MVNGSGAAVPQTAP-----YPQ---QPPAP----ALARPL 302
            |||...|......:.:..|.     ::|...|.||||.|     .|.   :||.|    ..|...
Mouse    32 APPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTD 96

  Fly   303 TQVYGAL-PE----NTQPAAVYLPAGGGAAVGPPGVAGPPIEQPGVGLPVSQSTDPQLQTQPADD 362
            ....||| |:    ::.||::.|.|.....:...||...|...|..                   
Mouse    97 AGTAGALTPQHVRAHSSPASLQLGAVSPGTLTASGVVSGPAAAPAA------------------- 142

  Fly   363 EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKP--TPLPPGWEIRKDGRGRVYYVDHNTRKTTWQR 425
                                 .:.|.:.:|.|  .|||.|||:.|...|:.|:::||.:.||||.
Mouse   143 ---------------------QHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQD 186

  Fly   426 PNSERLMHFQHWQGQRAHVVSQGNQRYLYSQQQQQPTAVTAQVTQD-DEDALGPLPDGWEKKIQS 489
            |              |..::||.|          .|...:..|.|. ...|.||||||||:.:..
Mouse   187 P--------------RKAMLSQLN----------VPAPASPAVPQTLMNSASGPLPDGWEQAMTQ 227

  Fly   490 DNRVYFVNHKNRTTQWEDPRTQGQEVSLINE-----GPL--PPGWEIRYTAAG------------ 535
            |..||::||||:||.|.|||...:....:|:     .|:  ||....:....|            
Mouse   228 DGEVYYINHKNKTTSWLDPRLDPRFGKAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQ 292

  Fly   536 ----------ERFFVDHNTRRTTFEDPRPGAPKGAK-GVYGVPRAYERSFRWKLSQFRYLCQSNA 589
                      ||..:   .::..|...||.|.:... .....|:..|.:.|   ||...|.|...
Mouse   293 IQLQQLQMEKERLRL---KQQELFRQVRPQAIRNINPSTANAPKCQELALR---SQLPTLEQDGG 351

  Fly   590 LPSHIK---ITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVL 651
            .|:.:.   ::...:|:..:|....:....|..|         :|..|.|               
Mouse   352 TPNAVSSPGMSQELRTMTTNSSDPFLNSGTYHSR---------DESTDSG--------------- 392

  Fly   652 NPMYCLFEYANKNNYSLQINPASYVN-----------------------PDHLQYFKFIGRFIAM 693
                     .:.::||:...|..::|                       ||:|:...  |..:.:
Mouse   393 ---------LSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALP--GTNVDL 446

  Fly   694 ALYHG--RFIYSGFTMPFYKRMLNKKLTIKDIETI------DPEFYNSLIWV 737
            ....|  ..|.....||..:..|:.:  |.|:|::      |.|.:  |.|:
Mouse   447 GTLEGDAMNIEGEELMPSLQEALSSE--ILDVESVLAATKLDKESF--LTWL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736 3/33 (9%)
WW 397..426 CDD:278809 14/28 (50%)
WW 478..509 CDD:197736 18/30 (60%)
WW 522..554 CDD:197736 7/55 (13%)
HECTc 594..946 CDD:238033 27/178 (15%)
HECTc 620..946 CDD:214523 24/149 (16%)
Yap1XP_006509915.1 FAM181 <61..>141 CDD:373671 22/79 (28%)
WW 159..188 CDD:238122 14/42 (33%)
WW 217..246 CDD:366073 16/28 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.