DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and YAP1

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens


Alignment Length:404 Identity:103/404 - (25%)
Similarity:148/404 - (36%) Gaps:129/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PNGGGD-----HRRSTQAPPVWEQ---QQQQSQNQQQPL--RMVNGSGAAVPQTAP-----YPQ- 291
            |:|.|.     .:.:.||||...|   .:..|:...:.|  .::|...|.||||.|     .|. 
Human    30 PSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDS 94

  Fly   292 --QPPAP----ALARPLTQVYGAL-PE----NTQPAAVYLPAGGGAAVGPPGVAGPPIEQPGVGL 345
              :||.|    ..|.......||| |:    ::.||::.|.|.....:.|.||...|     ...
Human    95 FFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGP-----AAT 154

  Fly   346 PVSQSTDPQLQTQPADDEPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGR 410
            |.:|.. .|...:..||.|||||||:.....|:||:::|                          
Human   155 PTAQHL-RQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNH-------------------------- 192

  Fly   411 VYYVDHNTRKTTWQRPNSERLMHFQHWQGQRAHVVSQGNQRYLYSQQQQQPTAVTAQVTQDD--E 473
               :|   :.||||.|....|                         .|...||.|:...|.:  .
Human   193 ---ID---QTTTWQDPRKAML-------------------------SQMNVTAPTSPPVQQNMMN 226

  Fly   474 DALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERF 538
            .|.||||||||:.:..|..:|::||||:||.|.|||             |.|           ||
Human   227 SASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPR-------------LDP-----------RF 267

  Fly   539 FVDHNTR---RTTFEDPRPGAPKGAK-GVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVT 599
            ....|.|   ....:.|.|.||:..: ||.|...:.::. :.:|.|.:.        ...::.:.
Human   268 GKAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQ-QMRLQQLQM--------EKERLRLK 323

  Fly   600 RQTLFEDSYHQIMR 613
            :|.|......|.||
Human   324 QQELLRQVRPQAMR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736 11/31 (35%)
WW 397..426 CDD:278809 5/28 (18%)
WW 478..509 CDD:197736 17/30 (57%)
WW 522..554 CDD:197736 7/34 (21%)
HECTc 594..946 CDD:238033 5/20 (25%)
HECTc 620..946 CDD:214523
YAP1XP_005271435.1 WW 174..203 CDD:238122 14/60 (23%)
WW 232..261 CDD:366073 15/28 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.