DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(dx) and herc5.3

DIOPT Version :9

Sequence 1:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_021330683.1 Gene:herc5.3 / 100073325 ZFINID:ZDB-GENE-070615-14 Length:1002 Species:Danio rerio


Alignment Length:388 Identity:108/388 - (27%)
Similarity:184/388 - (47%) Gaps:37/388 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 FRWKLSQFRYLCQSNALPS-------HIK---ITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFR 628
            |..|.|.| .|.|...:.|       |:.   :.:.|:::..|:. |.:|...|.....|.:.|.
Zfish   634 FLTKKSMF-ILLQEQCIRSLLDLLVVHLNGNLLHINRESVLTDTL-QYLRPFTYSFMHPLQVAFI 696

  Fly   629 GEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYV--NPDHLQ---YFKFIG 688
            ||:.:|...:|.|:|.|:|...:       |:..|   .|:::.:|.|  ||.|.|   .|.::|
Zfish   697 GEDEIDEKVISAEFFSLISKSFI-------EWDKK---ILEVHESSLVWFNPHHTQDHRDFYYLG 751

  Fly   689 RFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSV 753
            ....||||:...|...|.:..:|::|.:|.::.|:|.:.|....||..:.:.:.:|. ::|. .:
Zfish   752 VICGMALYNRHHINIDFPLALFKKLLQQKPSLDDLEELSPVEARSLKNLLEEDEEEV-VDLQ-HL 814

  Fly   754 DFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKY 818
            ||...||    ||..||.:.:|.:.|:::|:.|..::...:.::.|.:.|.|||:|..||:....
Zfish   815 DFTCKGQ----ELVPNGSQIQVNKVNRQKYVDLYVDFVFNKSVKTQFEQFTEGFSEGCPLDAWTM 875

  Fly   819 FDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRV 883
            |...||:.:|.|....:..:.|::..|...:.:.:.:..||....|...|.:.:.|.|:.||.||
Zfish   876 FHPEELQELLHGSPQYNWNELQQSASYEGCSASDELIKNFWTVFFELSEENKKKFLMFLYGTERV 940

  Fly   884 PVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGF 946
            |.|||:: ......|..|.:   .:..||.:.|||.||.||.|...:.|.:||..|:.....|
Zfish   941 PAGGFSK-RALKISQTDCPD---PDDHLPEAQTCFERLVLPKYSDINTLRDKLIHAVNSCAVF 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 99/359 (28%)
HECTc 620..946 CDD:214523 94/330 (28%)
herc5.3XP_021330683.1 RCC1 <74..349 CDD:332518
HECTc 665..1000 CDD:331829 100/356 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.