DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and HERC3

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:369 Identity:89/369 - (24%)
Similarity:158/369 - (42%) Gaps:26/369 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 MALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLF 677
            :.|.|:|..::..:::.:...|..|.....:|.|.||:.:|.||:.:|:|.|:...|.:...|:|
Human   702 LVLHVRRNNLVGDALRELSIHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMF 766

  Fly   678 CTFHDKHQALVHPNPTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGL 742
            ..:.|.:  |:..:.|  ..::...|...|...|..::.|.       :|...|..:...:|:.:
Human   767 TYYQDSN--LLWFSDT--CFVEHNWFHLIGITCGLAIYNST-------VVDLHFPLALYKKLLNV 820

  Fly   743 RVHYKYFEQDDPDLYLSKIKYILD---TDLDATDTLELYFVEEMYDSSSGQLSKTIELIPNGAKT 804
            :...:..::..|....| ::.:||   .|::.|..|......|.|    |.:.:. :|||.|...
Human   821 KPGLEDLKELSPTEGRS-LQELLDYPGEDVEETFCLNFTICRESY----GVIEQK-KLIPGGDNV 879

  Fly   805 RVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISD 869
            .|....:.:::||........:|.:...:|..|...:....:|.:|..:||..:|.|...|:..:
Human   880 TVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEE 944

  Fly   870 FKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELNPQFQITAAPT 934
            .:...|..|:.:.....:..||.....|...:..:.|.|.||..::|..|...|....|.||:  
Human   945 LEETAIYKGDYSATHPTVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQIVIQSTAS-- 1007

  Fly   935 FGN--LPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFGM 976
             |.  ||.||||:|.|.||.|.|.|.....|..|: :..|||.:
Human  1008 -GEEYLPVAHTCYNLLDLPKYSSKEILSARLTQAL-DNYEGFSL 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 88/364 (24%)
HECTc 642..974 CDD:214523 82/336 (24%)
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 88/366 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.