DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and HUL4

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_012570.3 Gene:HUL4 / 853494 SGDID:S000003797 Length:892 Species:Saccharomyces cerevisiae


Alignment Length:455 Identity:115/455 - (25%)
Similarity:206/455 - (45%) Gaps:61/455 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 RNIIAATFTHFLLKNIGGSETFK--------------DKQDFFYHEVRKFHASYYHEK------- 612
            |.:...|..:.|::..|.|.|.|              .|.....:|:|:.   ..||.       
Yeast   449 RGVAQKTKMNQLIEEWGNSTTKKCFSFCKYPFILSLGIKISIMEYEIRRI---MEHEAEQAFLIS 510

  Fly   613 ----------MALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCS 667
                      ..:||:|:.|...|::.:|... .|...:..:.|..|.|||.||||:|||.|:..
Yeast   511 LDKGKSVDVYFKIKVRRDVISHDSLRCIKEHQ-GDLLKSLRIEFVNEPGIDAGGLRKEWFFLLTK 574

  Fly   668 ALFDARGGLFCTFHDKHQ---ALVHPN--PTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLV 727
            :||:...|||....:..:   |:..||  .::..:.:|:.:...|.::|..:|.|.       ::
Yeast   575 SLFNPMNGLFIYIKESSRSWFAIDPPNFDKSKGKNSQLELYYLFGVVMGLAIFNST-------IL 632

  Fly   728 RARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMY-------- 784
            ..:|.::...:|....:.::.:.:..|:...:.||.:..|:.:..|...|.| |..|        
Yeast   633 DLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTF-ETTYRNNNWILN 696

  Fly   785 DSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPD-NLLS 848
            ||.|.:...|:||..||....:|.:.|::::....:..|..:::.:.:.|:.|...:..: |.:.
Yeast   697 DSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIK 761

  Fly   849 IFDENELELLMCGTGEYSISDFKAHHIAN---GNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTT 910
            :|:..|||.|:||..|.:..|||:.....   |..::..|.:.|||..:.::......:||||.|
Yeast   762 LFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVT 826

  Fly   911 GCSQLPPGGFQELNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFG 975
            ...::|..|...:..:..:..:....:||.||||||::||.:|.|.::.|..||.||:| |||:|
Yeast   827 ASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAINE-SEGYG 890

  Fly   976  975
            Yeast   891  890

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 102/376 (27%)
HECTc 642..974 CDD:214523 94/348 (27%)
HUL4NP_012570.3 HUL4 1..892 CDD:227354 115/455 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.