DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and UPL5

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_192994.1 Gene:UPL5 / 826870 AraportID:AT4G12570 Length:873 Species:Arabidopsis thaliana


Alignment Length:409 Identity:119/409 - (29%)
Similarity:179/409 - (43%) Gaps:47/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 FFYHEVRKFHA-------------SYYHEKMALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQ 647
            |.|.|...|.|             ..:.|...:.:.|..:|..|.:.:.|.|.....|...:.|:
plant   481 FEYKEATNFEARRHLAMLLFPDVKEDFEEMHEMLIDRSNLLSESFEYIVGASPEALHGGLFMEFK 545

  Fly   648 GEQGIDWGGLRREWFELVCSALFDARGGLFCTFHDKHQALVHPNPTR---PAHLKLKHFEFAGKM 709
            .|:... .|:.||||.|||..:|:.:..||....|..:.. .|||..   |.|...  |||.|::
plant   546 NEEATG-PGVLREWFYLVCQEIFNPKNTLFLRSADDFRRF-SPNPASKVDPLHPDF--FEFTGRV 606

  Fly   710 VGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTD---LDA 771
            :       ||...::..|...|.|.|..||.||::..:..:..|..:| :..|.||:.|   .|:
plant   607 I-------ALALMHKVQVGVLFDRVFFLQLAGLKISLEDIKDTDRIMY-NSCKQILEMDPEFFDS 663

  Fly   772 TDTLELYFVEEMYDSSSGQLSK--TIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSF 834
            ...|.|.||.|     :.:|.|  ||||.|:|....|.:..:.||:|.|.::|....:.::|..|
plant   664 NAGLGLTFVLE-----TEELGKRDTIELCPDGKLKAVNSKNRKQYVDLLIERRFATPILEQVKQF 723

  Fly   835 LKGLNSIIPDNL--LSIFDENELE----LLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAG 893
            .:|...::..::  .|.|....||    :|..|....||.|:|||...|| ..|..|.:.|||..
plant   724 SRGFTDMLSHSVPPRSFFKRLYLEDLDGMLRGGENPISIDDWKAHTEYNG-FKETDRQIDWFWKI 787

  Fly   894 VSNFSQTEMARLLQFTTGCSQLPPGGFQELNPQFQI-TAAPTFGNLPTAHTCFNQLCLPDYESYE 957
            :...::.|...:|.|.|....:|..||:.|:.:..| ........||.:||||.:||:|.|.:..
plant   788 LKKMTEEEQRSILFFWTSNKFVPVEGFRGLSSKLYIYRLYEANDRLPLSHTCFYRLCIPRYPTIT 852

  Fly   958 QFEKSL-LLAISEGSEGFG 975
            ..|:.| |:|....|..||
plant   853 LMEQRLRLIAQDHVSSSFG 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 111/375 (30%)
HECTc 642..974 CDD:214523 105/347 (30%)
UPL5NP_192994.1 UBQ 95..167 CDD:214563
ubiquitin 102..168 CDD:278661
HECTc 511..871 CDD:238033 111/377 (29%)
HECTc 540..860 CDD:214523 102/337 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11254
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.