DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Ube3b

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001137366.1 Gene:Ube3b / 687633 RGDID:1583074 Length:1070 Species:Rattus norvegicus


Alignment Length:536 Identity:141/536 - (26%)
Similarity:214/536 - (39%) Gaps:104/536 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 VTIKEMILKFIPKRIATFRLCPSTKFHFLPQLVSQLHGPVFIIDD----------------GAQP 560
            |||...:..|:.|.|.. .:..:.|...| :|...:||.:.::.:                ..:|
  Rat   563 VTISSFLNSFVFKMIWD-GIVENAKGETL-ELFQSVHGWLMVLYERDCRRRFAPEDHWLRKDLKP 625

  Fly   561 KI---ELASKDRNIIAATFTH-----------FLLKNIGGSETFKDKQDFFYHEVRKFHASYYHE 611
            .:   || .|||........|           .|.:|:    ..|:|:.....|.........| 
  Rat   626 GVLFQEL-DKDRKRAQLILLHIPHVVPHKNRVLLFRNM----VIKEKEKLGLVETSSASPHVTH- 684

  Fly   612 KMALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQG-----EQGIDWGGLRREWFELVCSALFD 671
               :.::|.::||...:.::........|...|.|..     |.|||..|:.:|:.|.:...:||
  Rat   685 ---ITIRRSRMLEDGYEQLRQLPQHAMKGAIRVKFVSDLGVDEAGIDQDGVFKEFLEEIIKRVFD 746

  Fly   672 ARGGLFCTFHDKHQALVHPNPTRPAHLK-LKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSF 735
            ....||.|.....:  ::|:||...|.. |:.|||.|||:||.::|..       :|...|:..|
  Rat   747 PALNLFKTTSGDER--LYPSPTSYIHENYLQLFEFVGKMLGKAVYEGI-------VVDVPFASFF 802

  Fly   736 LAQLIGLRVHYKYFEQD-------DPDLY--LSKIKYILDTDLDATDT-LELYFVEEMYDSSSGQ 790
            |:|::|  .|:..|...       |.:.|  |:.||..   |.|..|. |.|.:.|::    .||
  Rat   803 LSQMLG--HHHSVFYSSVDELPSLDSEFYKNLTSIKRY---DGDVADLGLTLSYDEDV----MGQ 858

  Fly   791 LSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENEL 855
            | ...||:|.|....||:..|..|:..:|..|:...:|::..:.:.|..|||....:.:|...||
  Rat   859 L-VCHELVPGGKTIPVTDENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPEL 922

  Fly   856 ELLMCG-TGEYSISDFKAHHIANGNSAEFRRVLAWFW-AGVSNFSQTEMARLLQFTTGCSQLPPG 918
            :.|:.| ..|..:.|.|.|.:..|......||:.|.| ...|:|:..|.|..|:|.|.||:.|..
  Rat   923 QRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIVWLWDILASDFTPGERAMFLKFVTSCSRPPLL 987

  Fly   919 GFQELNPQFQITAAPTF-------------------------GNLPTAHTCFNQLCLPDYESYEQ 958
            ||..|.|.|.|......                         |.|||:.||||.|.||:|.....
  Rat   988 GFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLPNYSKKSV 1052

  Fly   959 FEKSLLLAISEGSEGF 974
            ..:.|..|||..: ||
  Rat  1053 LREKLRYAISMNT-GF 1067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 117/403 (29%)
HECTc 642..974 CDD:214523 111/374 (30%)
Ube3bNP_001137366.1 HECTc 684..1068 CDD:238033 118/408 (29%)
HECTc 709..1067 CDD:214523 112/377 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.