DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and SMURF2

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_073576.1 Gene:SMURF2 / 64750 HGNCID:16809 Length:748 Species:Homo sapiens


Alignment Length:370 Identity:126/370 - (34%)
Similarity:189/370 - (51%) Gaps:38/370 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 LKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCT 679
            ::|.||:|.|.|.:.|......|......:.|:||:|:|:||:.|||..|:...:.:...|||..
Human   395 IEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQY 459

  Fly   680 FHDKHQAL-VHP-NPTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGL 742
            ..|....| ::| :...|.|  |.:|.|.|:::|..:|.    |.|   :...|:..|..||:|.
Human   460 SRDDIYTLQINPDSAVNPEH--LSYFHFVGRIMGMAVFH----GHY---IDGGFTLPFYKQLLGK 515

  Fly   743 RVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTIELIPNGAKTRVT 807
            .:.....|..||||:.|.: :||:.|:  |..|:..|..|  .::.|::.:. ||.|||....|.
Human   516 SITLDDMELVDPDLHNSLV-WILENDI--TGVLDHTFCVE--HNAYGEIIQH-ELKPNGKSIPVN 574

  Fly   808 NATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISDFKA 872
            ...|.:|:......|....::.:..:..||.|.:||.:||..|||.||||::||.|:..::|:|.
Human   575 EENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKV 639

  Fly   873 -----HHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQEL----NPQF- 927
                 |...:.|      ::.|||..|..|.:...||||||.||.|::|..||:.|    .|:. 
Human   640 NTRLKHCTPDSN------IVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLF 698

  Fly   928 ---QITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISE 969
               ||.|..  .|||.||||||::.:|.|||||:..:.||.||.|
Human   699 TIHQIDACT--NNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEE 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 126/370 (34%)
HECTc 642..974 CDD:214523 118/343 (34%)
SMURF2NP_073576.1 C2_Smurf-like 13..137 CDD:176028
HUL4 <159..745 CDD:227354 126/370 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.