DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and nedd4a

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001029358.1 Gene:nedd4a / 619412 ZFINID:ZDB-GENE-051005-2 Length:910 Species:Danio rerio


Alignment Length:404 Identity:131/404 - (32%)
Similarity:213/404 - (52%) Gaps:42/404 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 SETFKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSD------WCGNFEVT 645
            |..:|.|.::|..:::|  .:....:..|.|:|..:||.|.:.:.....|:      |     |.
Zfish   529 SRDYKQKYEYFRKKLKK--PAEIPNRFELSVRRNAVLEDSYRRILSVKRSELLKARLW-----VE 586

  Fly   646 FQGEQGIDWGGLRREWFELVCSALFDARGGLF-CTFHDKHQALVHPNPTRPAHLKLKHFEFAGKM 709
            |:||:|:|:||:.||||.|:...:|:...||| .:..|.:...::||........|.:|:|.|::
Zfish   587 FEGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRV 651

  Fly   710 VGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILD---TDLDA 771
            .|..::       :.:|:.|.|.|.|...::...:..:..|..|.: |.:.:::||:   ||||.
Zfish   652 AGMAVY-------HGKLLDAFFIRPFYKMMLQKPITLQDMESVDSE-YFNSLRWILENDPTDLDL 708

  Fly   772 TDTLELYFVEEMYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLK 836
            ..|::    ||::    ||..:. ||.|.||...|.:..|.:|:..:.|.|..:.::.::.:|.:
Zfish   709 RFTID----EELF----GQTHQH-ELKPGGADIVVNDTNKKEYIHLVMQWRFVDRIQRQMTAFKE 764

  Fly   837 GLNSIIPDNLLSIFDENELELLMCGTGEYSISDFKAH-HIANGNSAEFRRVLAWFWAGVSNFSQT 900
            |...:||.:|:.|||||||||||||.|:..::|::.: ...||.:.....:: |||..|......
Zfish   765 GFYELIPQDLIKIFDENELELLMCGLGDVDVNDWRENTKYKNGYNPNHPAII-WFWKTVLLMDAE 828

  Fly   901 EMARLLQFTTGCSQLPPGGFQEL----NPQ-FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFE 960
            :..|||||.||.|::|..||.||    .|| |.|....|...||.||||||:|.||. ||:|:..
Zfish   829 KRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGTREKLPRAHTCFNRLDLPPXESFEELR 893

  Fly   961 KSLLLAISEGSEGF 974
            :.|.:|| |.::||
Zfish   894 EKLHMAI-ENAQGF 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 126/376 (34%)
HECTc 642..974 CDD:214523 116/341 (34%)
nedd4aNP_001029358.1 C2_NEDD4_NEDD4L 22..153 CDD:175999
WW 194..223 CDD:366073
WW 349..378 CDD:366073
WW 435..465 CDD:238122
HECTc 577..906 CDD:214523 117/352 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.