DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Huwe1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_006528996.1 Gene:Huwe1 / 59026 MGIID:1926884 Length:4456 Species:Mus musculus


Alignment Length:398 Identity:135/398 - (33%)
Similarity:211/398 - (53%) Gaps:29/398 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 FKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDW 654
            |..|:.:|..|:.:.......|.||:.|:|:.:.|.|.:.:...|..:......:.|:||:|.|.
Mouse  4076 FDVKRKYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDA 4140

  Fly   655 GGLRREWFELVCSALFDARGGLFCTF-HDKHQALVHPNP-TRPAHLKLKHFEFAGKMVGKCLFES 717
            |||.|||:.::...:|:....||.|. .|:....::|:. ..|.|  |.:|:|.|::|.|.::::
Mouse  4141 GGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNH--LSYFKFVGRIVAKAVYDN 4203

  Fly   718 ALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEE 782
                   :|:...|:|||...::|..|.|...|.:|...|...: |:|:.|: :|...:|.|..|
Mouse  4204 -------RLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLV-YLLENDV-STLGYDLTFSTE 4259

  Fly   783 MYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLL 847
            :.:..   :.:..:|.||||...||...|.:|:..:.|.|:...::.::.:||:|...|||..|:
Mouse  4260 VQEFG---VCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLI 4321

  Fly   848 SIFDENELELLMCGTGEYSISDFKA---HHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFT 909
            |||.|.|||||:.|.....|.|.|:   :|....||.:    :.|||..:.:|.|.:.|:.|||.
Mouse  4322 SIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQ----IQWFWRALRSFDQADRAKFLQFV 4382

  Fly   910 TGCSQLPPGGFQELN-----PQFQITAAP-TFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAIS 968
            ||.|::|..||..|.     .:|||.... :...||:||||||||.||.|||:|:....|||||.
Mouse  4383 TGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQ 4447

  Fly   969 EGSEGFGM 976
            |.|||||:
Mouse  4448 ECSEGFGL 4455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 126/370 (34%)
HECTc 642..974 CDD:214523 120/342 (35%)
Huwe1XP_006528996.1 DUF908 92..367 CDD:399185
DUF913 431..892 CDD:399192
UBA_HUWE1 1395..1434 CDD:270474
WWE 1695..1756 CDD:397111
fibronec_FbpA <2809..>2992 CDD:411474
DUF4414 3044..3071 CDD:405126
DUF4414 3089..3120 CDD:405126
HECTc 4101..4454 CDD:238033 126/370 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.