DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and wwtr1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001032785.1 Gene:wwtr1 / 568008 ZFINID:ZDB-GENE-051101-1 Length:391 Species:Danio rerio


Alignment Length:56 Identity:16/56 - (28%)
Similarity:29/56 - (51%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PERLPELPPLDEQRLQRAALHL-----QQKLIL-REWLKDHRLQHHYQRLLAVEVA 134
            |.::|...|  :|:..:..::|     |||:.| |..::..|:|...:.|:..|||
Zfish   202 PVQVPVQAP--QQQSSQPMMNLSAQQHQQKMRLQRIQMERERIQRRQEELMRQEVA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
wwtr1NP_001032785.1 WW 115..146 CDD:197736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.