DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and yap1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001132952.1 Gene:yap1 / 561411 ZFINID:ZDB-GENE-030131-9710 Length:442 Species:Danio rerio


Alignment Length:189 Identity:37/189 - (19%)
Similarity:68/189 - (35%) Gaps:63/189 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PELPP---LDEQRLQRAA----------------------LHLQQKLILREWLKDHRLQHHYQRL 128
            |.|.|   :::||:.::|                      :.|||..|.:|.|   |::....|.
Zfish   217 PRLDPRFAMNQQRISQSAPVKQGSQLPSSPQSGVMSGNNPIRLQQIHIEKERL---RIKQELLRQ 278

  Fly   129 LAVEVA-------SLEDVYWLEDSRASKILGKDWQLWSGARQNLPTSKAQLDALKAQLWSTVVKS 186
            ...|:|       |:|.....::..:|..:|:|       .:|:.|:.:.         ..:...
Zfish   279 RPQELALRNQLPTSMEQDGGTQNPVSSPGMGQD-------ARNMTTNSSD---------PFLNSG 327

  Fly   187 SQH-QDAWTWGGMLVVSVSVAGLVTLAAMTQPSLAPEARHSLLQYVTGKYLLPANCKVQ 244
            :.| :|..|..|:.:.|.||           |....:..:|:.:..||..|.|.:...|
Zfish   328 TYHSRDESTDSGLSMSSYSV-----------PRTPDDFLNSVDEMETGDTLGPGSMATQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 2/7 (29%)
Filamin 238..336 CDD:279024 2/7 (29%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
yap1NP_001132952.1 FAM181 <41..186 CDD:291891
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..89
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..116
WW 127..158 CDD:197736
WW 188..217 CDD:278809 37/189 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..254 1/23 (4%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:P46937 247..442 31/159 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..374 20/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.