DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and PLEKHA5

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001243399.1 Gene:PLEKHA5 / 54477 HGNCID:30036 Length:1282 Species:Homo sapiens


Alignment Length:374 Identity:84/374 - (22%)
Similarity:130/374 - (34%) Gaps:125/374 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 KHQALVHPNPTRPAHL--KLKHFEFAGKMVGKCLFESAL-GGTYRQLVR--ARFSRSFLAQLIGL 742
            |::.|.|.......:|  ::|..|....||...:..||| ...|:|.:|  ::.|...|:|..|.
Human   661 KNEILSHHLQRNTIYLDHQMKENEPIITMVHTMIENSALRPQLYQQFLRQKSKISLYCLSQDEGR 725

  Fly   743 RVHYKYF-EQDDPDLYLSKI--------------------KYILDTD-LDATDTLELY------- 778
            ...|||. |:.|.|..||::                    ||.|:.. |.|:..:|::       
Human   726 GTLYKYRPEEVDIDAKLSRLCEQDKVVHALEEKLQQLHKEKYTLEQALLSASQEIEMHADNPAAI 790

  Fly   779 --FVEEMYDSSSGQLSKTIELIPNGAKTRVT-----------------NATKNQ---YLDALAQQ 821
              .|.:..|..:|.||...||      :|.|                 ..|:||   .||.|.  
Human   791 QTVVLQRDDLQNGLLSTCREL------SRATAELERAWREYDKLEYDVTVTRNQMQEQLDHLG-- 847

  Fly   822 RLCNNVKDEVDSFLKGL-NSIIPDNLLSIFDENE-----------LELLMCGTGEYSISDFKAHH 874
                    ||.:...|: .:.|...|..|.|..|           .|:.|.|:..:|...:|   
Human   848 --------EVQTESAGIQRAQIQKELWRIQDVMEGLSKHKQQRGTTEIGMIGSKPFSTVKYK--- 901

  Fly   875 IANGNSAEF----RRVLAWFWAGVSNFSQ---------TEMARLLQFTTGCSQLPPGGFQELNPQ 926
                |..|.    |..|...:    :|::         ::.:.||.::.|...||     |....
Human   902 ----NEEEEVVPPRPPLPRSY----DFTEQPPIIPPLPSDSSSLLCYSRGPVHLP-----EEKKM 953

  Fly   927 FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFG 975
            :|:...|..|    :|      |.|||..|:  .:..|..::|..|..|
Human   954 YQVQGYPRNG----SH------CGPDYRLYK--SEPELTTVAEVDESNG 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 83/372 (22%)
HECTc 642..974 CDD:214523 83/371 (22%)
PLEKHA5NP_001243399.1 WW 12..41 CDD:278809
WW 58..87 CDD:278809
PH_PEPP1_2_3 164..267 CDD:270068
PH 170..266 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.