DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and HERC5

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_011530324.2 Gene:HERC5 / 51191 HGNCID:24368 Length:1100 Species:Homo sapiens


Alignment Length:631 Identity:129/631 - (20%)
Similarity:236/631 - (37%) Gaps:168/631 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 NSRVSVTALFPEPTCL-----------RAVISYRD--------QQLPNGDFDIIVLSSSDTTLVH 467
            :::..:..:|..|.||           ..:..|.|        ::|...|:    :::..||.:.
Human   561 STKREIQEIFSSPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDW----ITNMITTCLK 621

  Fly   468 KNIASRK--HNICYEAKLLSIFGVSKNKP---------------RKVLCYVGPKQNSLIFQ---V 512
            .|:..|.  |:...||  |.||.:....|               .||:|.:. .|:||:.:   .
Human   622 DNLLKRLPFHSPPQEA--LEIFFLLPECPMMHISNNWESLVVPFAKVVCKMS-DQSSLVLEEYWA 683

  Fly   513 TIKEMILKFIPKRIATFRLCPSTKFHFLPQLVSQLHGPVFIIDDGAQPKIELASKDRNIIAATFT 577
            |::|.....:.:...|..:|....:.                        |.|.::.|:.|    
Human   684 TLQESTFSKLVQMFKTAVICQLDYWD------------------------ESAEENGNVQA---- 720

  Fly   578 HFLLKNIGGSETFKDKQDFFYHEVRKFHASYYHE--------------KMALK------VQREKI 622
              ||:.:                 :|.|.|..|:              :.||:      |:|..:
Human   721 --LLEML-----------------KKLHRSKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHL 766

  Fly   623 LESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCTFHDKHQAL 687
            :|..:..:..|...|......|:|.||.|.|.||:::|:|..:.:.:.....|:|          
Human   767 IEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMF---------- 821

  Fly   688 VHPN-------PTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVH 745
            ::|.       |.:|...|.::| |.|.:.|..||..       .:....|..:...:|:.....
Human   822 MYPEGASCMWFPVKPKFEKKRYF-FFGVLCGLSLFNC-------NVANLPFPLALFKKLLDQMPS 878

  Fly   746 YKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVE-----EMYDSSSGQLSKTIELIPNGAKTR 805
            .:..::..|||. ..::.:||.:.|..:  |::::.     :..|::         |||||:...
Human   879 LEDLKELSPDLG-KNLQTLLDDEGDNFE--EVFYIHFNVHWDRNDTN---------LIPNGSSIT 931

  Fly   806 VTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISDF 870
            |....|..|:.........::||...:.|.:|...:..::::.:|...||:.::.|..:|....|
Human   932 VNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTF 996

  Fly   871 K--AHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELNPQFQIT-AA 932
            :  |.:....||:  ...:..||......:..|..:.|.|.||..:|.   .::|| ..:|| ..
Human   997 EKNARYEPGYNSS--HPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQ---MKDLN-NMKITFCC 1055

  Fly   933 PTFGNLP---TAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFG 975
            |...|..   .|.|||:.|.||.|.:.|..|::|..||: .:.|||
Human  1056 PESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAIN-NNRGFG 1100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 87/383 (23%)
HECTc 642..974 CDD:214523 80/349 (23%)
HERC5XP_011530324.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.