DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Nedd4

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:414 Identity:145/414 - (35%)
Similarity:216/414 - (52%) Gaps:43/414 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 NIGG-----SETFKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSD----- 637
            ||.|     |..:|.|.::|...:||  .:....|..::::|..|||.|.:.:...:.:|     
  Fly   617 NIAGQAVPYSRDYKQKYEYFKSHIRK--PTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTK 679

  Fly   638 -WCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLF-CTFHDKHQALVHPNPTRPAHLKL 700
             |     |.|:||.|:|:|||.||||.|:...:|:...||| .:..|.:...::..........|
  Fly   680 LW-----VEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHL 739

  Fly   701 KHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYIL 765
            .:|:|.|::.|..::       :.:|:.|.|.|.|...::...:..|..|..|.: |.:.:.:|.
  Fly   740 SYFKFIGRIAGMAVY-------HGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTE-YYNSLMWIK 796

  Fly   766 DTDLDATDTLELYFV--EEMYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVK 828
            :.|   ...|||.|.  |:::    ||.|:. ||.|.||...|||..|::|:..:.:.|....||
  Fly   797 END---PRILELTFCLDEDVF----GQKSQH-ELKPGGANIDVTNENKDEYIKLVIEWRFVARVK 853

  Fly   829 DEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAG 893
            :::.|||.|..||||.||:.||||:||||||||.....:.|::.:.:..|:......::.|||..
  Fly   854 EQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRA 918

  Fly   894 VSNFSQTEMARLLQFTTGCSQLPPGGFQEL----NPQ-FQITAAPTFGNLPTAHTCFNQLCLPDY 953
            |.:||....:|||||.||.|::|..||:||    .|| |.|....|..|.|.||||||:|.||.|
  Fly   919 VLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPY 983

  Fly   954 ESYEQFEKSLLLAISEGSEGFGMV 977
            |.|.|.:..|:.|| |||:||..|
  Fly   984 EGYLQLKDKLIKAI-EGSQGFAGV 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 133/373 (36%)
HECTc 642..974 CDD:214523 125/339 (37%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 132/374 (35%)
HECTc 674..1003 CDD:214523 127/350 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446949
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.