DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Herc4

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:605 Identity:132/605 - (21%)
Similarity:239/605 - (39%) Gaps:150/605 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 VEKLQHAIVFAYDKVNSRVSVTALFPEPTCLRAVISYRDQQLP-NGDFDIIVLSSSDTTLVHKNI 470
            |:...|.::..   ::.::.:.|..|.       ...|.|.|| |.:.:||:             
  Fly   574 VQNFLHVVIHI---ISFKMGLAAASPS-------AERRQQLLPYNTELEIIL------------- 615

  Fly   471 ASRKHNICYEAKLLSIFGVSKNKPRKVLCYV-GPKQNSLIFQV----------TIKEMILKFIPK 524
                       ||:           |.||.: ..:.:.|.:|:          .:::..:|:|..
  Fly   616 -----------KLM-----------KTLCQINNERHDRLNYQIFYWPDLSDYADVQQEYVKWIMA 658

  Fly   525 RIA-TFRLCPSTKFHFLPQLVSQLHGPVFIIDDGAQ-------PKIELASKDRNIIAATFTHFLL 581
            ..| .|.:|..:                ||.|..|:       ..:::.|...|.....|:.|  
  Fly   659 DTARDFNICNYS----------------FIFDQSAKTALLQADQALQMHSAMANAATMAFSFF-- 705

  Fly   582 KNIGGSETFKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSDWCGNFEVTF 646
             |.|             ..:.:|        :.|.|.||.:::.|::.::.:|.||.....::.|
  Fly   706 -NYG-------------MPISQF--------IVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKF 748

  Fly   647 QGEQGIDWGGLRREWFELVCSALFDARGGLFCTFHDKHQALVHPNPTRPAHLKLKHFE------F 705
            .||:..|.||:|:|:|.|:...|.|.:.|:|..: ::.:.|...:.|         ||      .
  Fly   749 HGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEY-EQSRLLWFADLT---------FETENMYFL 803

  Fly   706 AGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILD-TDL 769
            .|.:.|..::...       ::...|..:...:|:|..|......|..|. ..:.::.:|| ...
  Fly   804 IGVLCGLAIYNFT-------IINLPFPLALFKKLLGKPVDLSDLRQLSPP-EANSMQSLLDYQGD 860

  Fly   770 DATDTLELYFVEEMYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSF 834
            |..:..:|.|  |:.....|: ::|..|.|||.:..||...:.:::|.........:|:...::|
  Fly   861 DFKEVFDLTF--EISRDVFGE-AETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAF 922

  Fly   835 LKGLNSIIPDNLLSIFDENELELLMCGTGEYSISDFKAHHIANGNSAEFRR-------VLAWFWA 892
            .||...:....::.||...||..::.|..:|   |::|..    ::.|:|.       .:.|||.
  Fly   923 HKGFMKVCSGRVIHIFQPEELMAVVVGNEDY---DWQALQ----DNCEYREGYTSVDDTIKWFWE 980

  Fly   893 GVSNFSQTEMARLLQFTTGCSQLPPGGFQELNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYE 957
            .:.:.|:.|....|.|.||..::|..|.:.|....|.|....|  ||.||||||.|.||.|::.|
  Fly   981 VIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQPTPDERF--LPVAHTCFNLLDLPRYKTKE 1043

  Fly   958 QFEKSLLLAISEGSEGFGMV 977
            :.:..||.||.: ::||.:|
  Fly  1044 RLKYKLLQAIQQ-TQGFSLV 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 96/373 (26%)
HECTc 642..974 CDD:214523 87/345 (25%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 96/375 (26%)
HECTc 739..1059 CDD:214523 88/350 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.