DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Su(dx)

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster


Alignment Length:373 Identity:119/373 - (31%)
Similarity:192/373 - (51%) Gaps:35/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 LKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCT 679
            :.|.|:.:.|.|...:......:......:.|:||:|:|:||:.||||.|:...:.:.   ::|.
  Fly   596 ITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNP---MYCL 657

  Fly   680 FH--DKHQALVHPNP---TRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQL 739
            |.  :|:...:..||   ..|.|  |::|:|.|:.:...|:       :.:.:.:.|:..|..::
  Fly   658 FEYANKNNYSLQINPASYVNPDH--LQYFKFIGRFIAMALY-------HGRFIYSGFTMPFYKRM 713

  Fly   740 IGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTIELIPNGAKT 804
            :..::..|..|..||:.|.|.| ::.|.::|... |||:|..:.  ...||:... ||..||.|.
  Fly   714 LNKKLTIKDIETIDPEFYNSLI-WVKDNNIDECG-LELWFSVDF--EVLGQIIHH-ELKENGEKE 773

  Fly   805 RVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISD 869
            |||...|.:|:..:.:.|:...::.:..:||:|.|.::|...|..|||.||||::||..:..:.|
  Fly   774 RVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVED 838

  Fly   870 FKAHHI---ANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQEL----NPQ- 926
            ::.:.|   .|.||.:    :.|||..|......:.||||||.||..::|.|||.||    .|| 
  Fly   839 WQRNTIYRHYNRNSKQ----VVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQR 899

  Fly   927 FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGF 974
            |.|........||.:|||||:|.||.|:||:|..:.|..||.| :|||
  Fly   900 FCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEE-TEGF 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 119/373 (32%)
HECTc 642..974 CDD:214523 113/344 (33%)
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988
WW 364..396 CDD:197736
WW 397..426 CDD:278809
WW 478..509 CDD:197736
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033 117/371 (32%)
HECTc 620..946 CDD:214523 113/347 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.