DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and smurf1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001001943.1 Gene:smurf1 / 321695 ZFINID:ZDB-GENE-040426-2744 Length:731 Species:Danio rerio


Alignment Length:372 Identity:122/372 - (32%)
Similarity:190/372 - (51%) Gaps:39/372 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 LKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCT 679
            ::|.||:|.|.|.:.:......|......|.|:||:|:|:||:.|||..|:|..:.:...|||..
Zfish   375 IEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQY 439

  Fly   680 FHDKHQAL-VHPNPT-RPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGL 742
            ..|....| ::|:.: .|.|  |.:|.|.|:::|..:|.    |.|   :...|:..|..||:|.
Zfish   440 STDNIYTLQINPDSSINPDH--LSYFHFVGRIMGLAVFH----GHY---INGGFTLPFYKQLLGK 495

  Fly   743 RVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTIELIPNGAKTRVT 807
            .:.....|..||:|:.|.: :||:.|:  |..|:..|..|  .::.|:..:. ||.|||....||
Zfish   496 PIQLCDLETVDPELHKSLV-WILENDI--TSVLDHTFCVE--HNAFGKFLQH-ELKPNGKNIPVT 554

  Fly   808 NATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISDFKA 872
            ...|.:|:......|....::.:..:..||.|.:||.:||..||..||||::.|.|:..::|:||
Zfish   555 EENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDNKELELIIGGLGKIDLNDWKA 619

  Fly   873 -----HHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELNPQFQITAA 932
                 |.:|:.|      ::.|||..|.:|.:....|||||.||.:::|..||:.|..... :|.
Zfish   620 NTRLKHCVADSN------IVKWFWQAVESFDEERRGRLLQFVTGSTRVPLQGFKALQGSTG-SAG 677

  Fly   933 PTF----------GNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISE 969
            |..          .|||.||||||::.:|.|||||:..:.||.|:.|
Zfish   678 PRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEE 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 122/372 (33%)
HECTc 642..974 CDD:214523 115/345 (33%)
smurf1NP_001001943.1 C2_Smurf-like 14..138 CDD:176028
WW 234..266 CDD:197736
WW 280..312 CDD:197736
HECTc 373..728 CDD:238033 122/372 (33%)
HECTc 397..728 CDD:214523 116/350 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.