DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Smurf2

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001100531.1 Gene:Smurf2 / 303614 RGDID:1310067 Length:748 Species:Rattus norvegicus


Alignment Length:370 Identity:130/370 - (35%)
Similarity:191/370 - (51%) Gaps:38/370 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 LKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCT 679
            ::|.||:|.|.|.:.|......|......:.|:||:|:|:||:.|||..|:...:.:...|||..
  Rat   395 IEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQY 459

  Fly   680 FHDKHQAL-VHP-NPTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSFLAQLIGL 742
            ..|....| ::| :...|.|  |.:|.|.|:::|..:|.    |.|   :...|:..|..||:|.
  Rat   460 SRDDIYTLQINPDSAVNPEH--LSYFHFVGRIMGMAVFH----GHY---IDGGFTLPFYKQLLGK 515

  Fly   743 RVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTIELIPNGAKTRVT 807
            .:.....|..||||:.|.: :||:.|:  |..|:..|..|  .::.|::.:. ||.|||....||
  Rat   516 SITLDDMELVDPDLHNSLV-WILENDI--TGVLDHTFCVE--HNAYGEIIQH-ELKPNGKSIPVT 574

  Fly   808 NATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSISDFKA 872
            ...|.:|:......|....::.:..:..||.|.:||.:||..|||.||||::||.|:..:||:||
  Rat   575 EENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVSDWKA 639

  Fly   873 -----HHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQEL----NPQF- 927
                 |...:.|      |:.|||..|..|.:...||||||.||.|::|..||:.|    .|:. 
  Rat   640 NTRLKHCTPDSN------VVKWFWKAVELFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLF 698

  Fly   928 ---QITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISE 969
               ||.|..  .|||.||||||::.:|.|||||:..:.||.||.|
  Rat   699 TIHQIDACT--NNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEE 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 130/370 (35%)
HECTc 642..974 CDD:214523 122/343 (36%)
Smurf2NP_001100531.1 C2_Smurf-like 13..137 CDD:176028
PRP40 155..>236 CDD:227435
WW 159..188 CDD:395320
WW 252..283 CDD:197736
WW 298..330 CDD:197736
HECTc 393..745 CDD:238033 130/370 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.