DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Wwtr1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001020040.1 Gene:Wwtr1 / 295062 RGDID:1559609 Length:395 Species:Rattus norvegicus


Alignment Length:32 Identity:12/32 - (37%)
Similarity:16/32 - (50%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 AMTQPSLAPEARHSLLQYVTGKYLLPANCKVQ 244
            |::||:||...:|   |.|....|.|.|...|
  Rat   183 AVSQPNLAMNHQH---QQVVATSLSPQNHPAQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 3/7 (43%)
Filamin 238..336 CDD:279024 3/7 (43%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
Wwtr1NP_001020040.1 WW 125..156 CDD:197736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.