DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Bag3

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:188 Identity:45/188 - (23%)
Similarity:61/188 - (32%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SMGISSLSSCGDPERLPELPPLDEQRLQRAA----LHLQQKLILREWLKDHRLQHHYQRLLAVEV 133
            |.|.|||.|...|.....:|.:.||.:.|.|    .|..||.             ||..... |.
  Rat   193 SSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKT-------------HYPAQQG-EY 243

  Fly   134 ASLEDVYWLEDSRASKILGKDWQLWSGARQNLPTSKAQLDALKAQLWSTVVKSSQHQDAWTWGGM 198
            ...:.||       .||.|.||:    .|....||..:         |.|..:|..:.:....|.
  Rat   244 QPQQPVY-------HKIQGDDWE----PRPLRATSPFR---------SPVRGASSREGSPARSGT 288

  Fly   199 LVVSVSVAGLVTLA------------AMTQPSLAPEARHSLLQYVTGKYLLPANCKVQ 244
            .|...|...:.|:.            .:|||...||::..|    .|..|.|.:..:|
  Rat   289 PVHCPSPIRVHTVVDRPQPMTHREPPPVTQPENKPESKPGL----AGPDLPPGHIPIQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 2/7 (29%)
Filamin 238..336 CDD:279024 2/7 (29%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
Bag3NP_001011936.1 WW 23..55 CDD:197736
BAG 423..500 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.