DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Nedd4l

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_038952600.1 Gene:Nedd4l / 291553 RGDID:735047 Length:1259 Species:Rattus norvegicus


Alignment Length:400 Identity:133/400 - (33%)
Similarity:212/400 - (53%) Gaps:34/400 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 SETFKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSD------WCGNFEVT 645
            |..||.|.|:|..:::|  .:....:..:|:.|..|.|.|.:.:......|      |     :.
  Rat   878 SREFKQKYDYFRKKLKK--PADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLW-----IE 935

  Fly   646 FQGEQGIDWGGLRREWFELVCSALFDARGGLF-CTFHDKHQALVHPNPTRPAHLKLKHFEFAGKM 709
            |:.|:|:|:||:.||||.|:...:|:...||| .:..|.:...::||........|.:|.|.|::
  Rat   936 FESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRV 1000

  Fly   710 VGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDT 774
            .|..:|       :.:|:...|.|.|...::|.::.....|..|.: |.:.:|:||:.|   ...
  Rat  1001 AGLAVF-------HGKLLDGFFIRPFYKMMLGKQITLNDMESVDSE-YYNSLKWILEND---PTE 1054

  Fly   775 LELYFVEEMYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLN 839
            |:|.|..:  :.:.|| :..::|.|||::..|||..|.:|:|.:.|.|..|.|:.::::||:|..
  Rat  1055 LDLMFCID--EENFGQ-TYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFT 1116

  Fly   840 SIIPDNLLSIFDENELELLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMAR 904
            .::|.:|:.|||||||||||||.|:..::|::.|.|..........|:.|||..|......:..|
  Rat  1117 ELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIR 1181

  Fly   905 LLQFTTGCSQLPPGGFQEL----NPQ-FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLL 964
            ||||.||.|::|..||.||    .|| |.|....:...||.||||||:|.||.||::|...:.||
  Rat  1182 LLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLL 1246

  Fly   965 LAISEGSEGF 974
            :|: |.::||
  Rat  1247 MAV-ENAQGF 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 125/371 (34%)
HECTc 642..974 CDD:214523 117/337 (35%)
Nedd4lXP_038952600.1 C2 <365..418 CDD:417471
WW 463..489 CDD:395320
WW 653..682 CDD:395320
WW 766..796 CDD:238122
WW 815..865 CDD:197736
HECTc 926..1255 CDD:214523 119/348 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.