DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and HERC4

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:376 Identity:92/376 - (24%)
Similarity:160/376 - (42%) Gaps:38/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 MALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLF 677
            :.|.|:||.|:..:|:.::.....|:....:|.|.||..:|.||:|:|:|.|:...|.|.:.|:|
Human   733 LILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMF 797

  Fly   678 CTFHDKHQALVHPNPTRPAHLKLKHFEFAGKMVGKCLFESALG------GTYRQLVRARFSRSFL 736
            ..:.|.............:.|    |...|.:.|..::...:.      ..|::|::.:.|...|
Human   798 RYYEDSRLIWFSDKTFEDSDL----FHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDL 858

  Fly   737 AQLIGLRVHYKYFEQDDPDLYLSKIKYILD---TDLDATDTLELYFVEEMYDSSSGQLSKTIELI 798
            .:|:             ||:..| ::.:||   .|::.|..|......|.:.:     ::..||:
Human   859 KELM-------------PDVGRS-MQQLLDYPEDDIEETFCLNFTITVENFGA-----TEVKELV 904

  Fly   799 PNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTG 863
            .|||.|.|....:.:::||........:|....|:|..|.:.:....:|.:|..|||:.::.|..
Human   905 LNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNT 969

  Fly   864 EYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELNPQFQ 928
            .|...:.:.:....|........:..||.........:..:.|.|.||..::|..|.:.|....|
Human   970 NYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQ 1034

  Fly   929 ITAAPTFGN--LPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFGMV 977
            .|..   |.  ||.:|||||.|.||.|...|.....|:.|| :.:|||.::
Human  1035 STGG---GEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAI-DHNEGFSLI 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 91/370 (25%)
HECTc 642..974 CDD:214523 83/342 (24%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 91/372 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.