DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and WWTR1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001161750.1 Gene:WWTR1 / 25937 HGNCID:24042 Length:400 Species:Homo sapiens


Alignment Length:107 Identity:25/107 - (23%)
Similarity:43/107 - (40%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VSHINVGGVMHAATGGK---------TFPTLKVKLCFGESMGISSLSSCGDPERLP-----ELP- 92
            ::|:|    :|.|....         :.|.|.:.....:.|..|:||....|.:.|     .:| 
Human   163 LNHMN----LHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPN 223

  Fly    93 PLDEQRLQRAALHLQQKLILREWLKDHRLQHHYQRLLAVEVA 134
            .|..|:.|:..|.||:..:.||     |::...:.|:..|.|
Human   224 ALTTQQQQQQKLRLQRIQMERE-----RIRMRQEELMRQEAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
WWTR1NP_001161750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..117
WW 125..156 CDD:197736
Required for interaction with PALS1. /evidence=ECO:0000269|PubMed:21145499 222..400 13/44 (30%)
PDZ-binding 394..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.