DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Plekha7

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_017177675.1 Gene:Plekha7 / 233765 MGIID:2445094 Length:1359 Species:Mus musculus


Alignment Length:252 Identity:46/252 - (18%)
Similarity:83/252 - (32%) Gaps:92/252 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYKGRPPDHATRFD----ISMLVSHINVGG---VMHAATGGKTFPTLKVKLCFGESMGISSLSSC 82
            |.:..|..|.::.:    .|.:||..:..|   .:.|..|.|...:......||:.         
Mouse    97 VLREEPHPHMSKPERNQRPSSMVSETSTAGTTSTLEAKPGPKIVKSSSKVHSFGKR--------- 152

  Fly    83 GDPERLPELPPLDEQRLQRAALHLQQKLILREWLKDHRLQHHYQRLLAVEVASLED--VYWLEDS 145
                         :|.::|   :|...:::|.||  |:......||.......|.|  :::.:||
Mouse   153 -------------DQAIRR---NLNVPVVVRGWL--HKQDSSGMRLWKRRWFVLADYCLFYYKDS 199

  Fly   146 RASKILGKDWQLWSGARQNLP-------------------TSKAQLDALKAQLWSTVVKSSQHQD 191
            |...:||           ::|                   :.||....::|.::||....||.:.
Mouse   200 REEAVLG-----------SIPLPSYVISPVAPEDRISRKYSFKAVHTGMRALIYSTTTAGSQMEH 253

  Fly   192 AWTWGGMLVVSVSVAGLVTLAA-----------MTQPSL-----------APEARHS 226
            :    ||.....|...|..:.|           :::.||           .|:|.|:
Mouse   254 S----GMRTYYFSADTLEDMNAWVRAMNQAAQVLSRSSLRRDVDKVERQAMPQANHT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
Plekha7XP_017177675.1 WW 10..39 CDD:366073
WW 55..84 CDD:366073
PH_PEPP1_2_3 158..280 CDD:270068 28/141 (20%)
Smc <692..>894 CDD:224117
PHA03247 <903..1009 CDD:223021
PRK10263 <912..>1118 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.