DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and NEDD4L

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_006722489.1 Gene:NEDD4L / 23327 HGNCID:7728 Length:1019 Species:Homo sapiens


Alignment Length:452 Identity:144/452 - (31%)
Similarity:226/452 - (50%) Gaps:46/452 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 LHGPVFIIDDGAQ-------PKIELASKDRNIIAATFTHFLLKNIGG-----SETFKDKQDFFYH 599
            |.|..|.||..:|       .:..:.|.|..|............|.|     |..||.|.|:|..
Human   586 LDGRTFYIDHSSQVLCGENDTRESVPSYDSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRK 650

  Fly   600 EVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSD------WCGNFEVTFQGEQGIDWGGLR 658
            :::|  .:....:..:|:.|..|.|.|.:.:......|      |     :.|:.|:|:|:||:.
Human   651 KLKK--PADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLW-----IEFESEKGLDYGGVA 708

  Fly   659 REWFELVCSALFDARGGLF-CTFHDKHQALVHPNPTRPAHLKLKHFEFAGKMVGKCLFESALGGT 722
            ||||.|:...:|:...||| .:..|.:...::||........|.:|.|.|::.|..:|       
Human   709 REWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVF------- 766

  Fly   723 YRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSS 787
            :.:|:...|.|.|...::|.::.....|..|.: |.:.:|:||:.|   ...|:|.|..:  :.:
Human   767 HGKLLDGFFIRPFYKMMLGKQITLNDMESVDSE-YYNSLKWILEND---PTELDLMFCID--EEN 825

  Fly   788 SGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDE 852
            .|| :..::|.|||::..|||..|.:|:|.:.|.|..|.|:.::::||:|...::|.:|:.||||
Human   826 FGQ-TYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDE 889

  Fly   853 NELELLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPP 917
            |||||||||.|:..::|::.|.|..........|:.|||..|......:..|||||.||.|::|.
Human   890 NELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPM 954

  Fly   918 GGFQEL----NPQ-FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGF 974
            .||.||    .|| |.|....:...||.||||||:|.||.||::|...:.||:|: |.::||
Human   955 NGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAV-ENAQGF 1015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 126/372 (34%)
HECTc 642..974 CDD:214523 117/337 (35%)
NEDD4LXP_006722489.1 C2_NEDD4_NEDD4L 21..179 CDD:175999
WW 224..250 CDD:278809
WW 413..442 CDD:278809
WW 526..556 CDD:238122
WW 575..625 CDD:197736 9/38 (24%)
HECTc 662..1016 CDD:238033 126/374 (34%)
HECTc 686..1015 CDD:214523 119/348 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.