DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and WWC1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_011532787.1 Gene:WWC1 / 23286 HGNCID:29435 Length:1185 Species:Homo sapiens


Alignment Length:317 Identity:65/317 - (20%)
Similarity:105/317 - (33%) Gaps:102/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SSLSSCGDPERL-PELPPLDEQ--RLQRAALHLQQKLILREWLKDHRLQHHYQRLLAVE--VASL 136
            ||.||..|||.| .|:.....:  :|:|..:|||.:|..:|        ..:|.|..::  ::..
Human   149 SSSSSKYDPEILKAEIATAKSRVNKLKREMVHLQHELQFKE--------RGFQTLKKIDKKMSDA 205

  Fly   137 EDVYWLEDSRA----SKILGKDWQLWSGARQNLPTSKAQL-DALKAQLWSTVVKSSQHQDAWTWG 196
            :..|.|::::|    :|.:.|........:|:|..|.|.| |..:....|       |.|.|:..
Human   206 QGSYKLDEAQAVLRETKAIKKAITCGEKEKQDLIKSLAMLKDGFRTDRGS-------HSDLWSSS 263

  Fly   197 GMLVVS--------------VSVAGLVTLAAMTQPSLAPEARHSLLQYVTGKYLLPANCKVQWDW 247
            ..|..|              ..::|...:.:..|  ||.:.| ..|:|...|..|...|      
Human   264 SSLESSSFPLPKQYLDVSSQTDISGSFGINSNNQ--LAEKVR-LRLRYEEAKRRLSCQC------ 319

  Fly   248 KDPASVGGTMCFVVRFFQRNGQPYPI-CDTDHFFVEVTEGTRKVV---------------TISEL 296
                                ||..|. .:..|:  ::.:.:.|..               |...|
Human   320 --------------------GQATPSNSELTHY--QLPQASSKTARHLYLDSHFLFSLKRTTLNL 362

  Fly   297 GSSTDPNNANIAKVKFTVRTAGQYKISVLIGASHIAGSPFLRSFLPGAIDARRSRFI 353
            ||.....||       .:|.....||.:         :.......||.:|:.|.|.|
Human   363 GSVPSCRNA-------CLRWIANLKIQL---------AKLDSEAWPGVLDSERDRLI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 15/113 (13%)
Filamin 238..336 CDD:279024 15/113 (13%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
WWC1XP_011532787.1 WW 9..39 CDD:238122
WW 55..84 CDD:278809
ALDH-SF 429..>481 CDD:299846
C2_Kibra 721..844 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.