DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Wwc1

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_740749.1 Gene:Wwc1 / 211652 MGIID:2388637 Length:1104 Species:Mus musculus


Alignment Length:484 Identity:97/484 - (20%)
Similarity:159/484 - (32%) Gaps:155/484 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SSLSSCGDPERL-PELPPLDEQ--RLQRAALHLQQKLILREWLKDHRLQHHYQRLLAVE--VASL 136
            ||.||..|||.| .|:.....:  :|:|..:|||.:|..:|        ..:|.|..::  ::..
Mouse   149 SSSSSKYDPEILKAEIATAKSRVNKLKREMVHLQHELQFKE--------RGFQTLKKIDERMSDA 205

  Fly   137 EDVYWLEDSRA----SKILGKDWQLWSGARQNLPTSKAQL-DALKAQLWSTVVKSSQHQDAWTWG 196
            :..|.|::::|    :|.:.|........:|:|..|.|.| |..:....|       |.|.|:..
Mouse   206 QGGYKLDEAQAVLRETKAIKKAITCGEKEKQDLIKSLAMLKDGFRTDRGS-------HSDLWSSS 263

  Fly   197 GMLVVS--------------VSVAGLVTLAAMTQPSLAPEARHSLLQYVTGKYLLPANCKVQWDW 247
            ..|..|              ..::|..:.::..|  ||.:.| ..|:|...|..: ||.|:|...
Mouse   264 SSLESSSFPMPKQFLDVSSQTDISGSFSTSSNNQ--LAEKVR-LRLRYEEAKRRI-ANLKIQLAK 324

  Fly   248 KDPASVGGT----------------MCFVVRFFQ--------------------------RNGQP 270
            .|..:..|.                :...:||..                          |:.|.
Mouse   325 LDSEAWPGVLDSERDRLILINEKEELLKEMRFISPRKWTQGEVEQLEMARRRLEKDLQAARDTQS 389

  Fly   271 YPICD-------TDHFFVEVTEGTRKVVTI-----------SELGSSTDPNNANIAKVKFTVRTA 317
            ..:.:       .:....|:.|.||:|.|:           ..|.|.:.|.:...::...   .|
Mouse   390 KALTERLKLNSKRNQLVRELEEATRQVATLHSQLKSLSSSMQSLSSGSSPGSLTSSRGSL---AA 451

  Fly   318 GQYKISVLIGASHIAGSPF------LRS-----FLPGAIDARRSRFIRPASTVICCAGAPTLMHI 371
            .....|.....:.:...||      |:|     ||.||...|.|             |..|.:| 
Mouse   452 SSLDSSTSASFTDLYYDPFEQLDSELQSKVELLFLEGATGFRPS-------------GCITTIH- 502

  Fly   372 EPRDEFGNSCLFDQNQSDEALQGYQVAIYDLHGVPVEKLQHAIVFAYDKVNSRVSVTALFPEPTC 436
              .||...:   .:.:....||    |:..|.|.|         .:...::.|.|:::  |.|.|
Mouse   503 --EDEVAKT---QKAEGGSRLQ----ALRSLSGTP---------RSMTSLSPRSSLSS--PSPPC 547

  Fly   437 LRAVISYRDQQLPNGDFDIIVLSSSDTTL 465
            ...:    ...|..||..:..|...||.|
Mouse   548 SPLI----TDPLLTGDAFLAPLEFEDTEL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 21/157 (13%)
Filamin 238..336 CDD:279024 21/157 (13%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
Wwc1NP_740749.1 WW 9..39 CDD:238122
WW 55..84 CDD:278809
ALDH-SF 378..>420 CDD:299846 8/41 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..449 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..547 10/55 (18%)
C2_Kibra 661..784 CDD:176062
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..949
Interaction with histone H3. /evidence=ECO:0000250 836..1104
Interaction with PRKCZ. /evidence=ECO:0000250 945..988
ADDV motif 1102..1104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.