DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Nedd4

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001344927.1 Gene:Nedd4 / 17999 MGIID:97297 Length:1207 Species:Mus musculus


Alignment Length:403 Identity:135/403 - (33%)
Similarity:213/403 - (52%) Gaps:40/403 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 SETFKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSD------WCGNFEVT 645
            |..:|.|.:||..:::|  .:....|..:|::|..|||.|.:.:.|...:|      |     :.
Mouse   826 SRDYKRKYEFFRRKLKK--QTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLW-----IE 883

  Fly   646 FQGEQGIDWGGLRREWFELVCSALFDARGGLF-CTFHDKHQALVHPNPTRPAHLKLKHFEFAGKM 709
            |.||:|:|:||:.||||.|:...:|:...||| .:..|.:...::||........|.:|:|.|::
Mouse   884 FDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRV 948

  Fly   710 VGKCLFESALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDT 774
            .|..::       :.:|:...|.|.|...::...:.....|..|.: |.|.:::||:.|   ...
Mouse   949 AGMAVY-------HGKLLDGFFIRPFYKMMLQKLITLHDMESVDSE-YYSSLRWILEND---PTE 1002

  Fly   775 LELYFV--EEMYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKG 837
            |:|.|:  ||::    ||..:. ||...|::..|||..|.:|:..:.|.|..|.::.::.:|.:|
Mouse  1003 LDLRFIIDEELF----GQTHQH-ELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEG 1062

  Fly   838 LNSIIPDNLLSIFDENELELLMCGTGEYSISDFKAH-HIANGNSAEFRRVLAWFWAGVSNFSQTE 901
            ...:||.:|:.|||||||||||||.|:..::|::.| ...||.|.. .:|:.|||..|......:
Mouse  1063 FFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMN-HQVIHWFWKAVWMMDSEK 1126

  Fly   902 MARLLQFTTGCSQLPPGGFQEL----NPQ-FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEK 961
            ..|||||.||.|::|..||.||    .|| |.:....|...||.||||||:|.||.|||:::...
Mouse  1127 RIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLPPYESFDELWD 1191

  Fly   962 SLLLAISEGSEGF 974
            .|.:|| |.::||
Mouse  1192 KLQMAI-ENTQGF 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 128/375 (34%)
HECTc 642..974 CDD:214523 117/340 (34%)
Nedd4NP_001344927.1 C2 <477..530 CDD:326325
WW 574..602 CDD:238122
WW 727..756 CDD:306827
WW 781..813 CDD:197736
HECTc 874..1203 CDD:214523 119/351 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.