DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Gas7

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_006532265.1 Gene:Gas7 / 14457 MGIID:1202388 Length:476 Species:Mus musculus


Alignment Length:305 Identity:58/305 - (19%)
Similarity:107/305 - (35%) Gaps:89/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 NIIAATFTHFLLKNIGGSETFKDKQDFFYHEVRKFHASYYHEKMALKVQRE------KILESSMK 628
            |...|.|...|.|.:.|.:..|:..:|.              :..:|::.|      |:.::|:.
Mouse   214 NGTVAGFELLLQKQLKGKQMQKEMSEFI--------------RERIKIEEEYAKNLAKLSQNSLA 264

  Fly   629 AVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCTFHDKHQALVHPNPT 693
            |.:               :|..|..|..:::        :|.|.     ...|.|..|.:|....
Mouse   265 AQE---------------EGSLGEAWAQVKK--------SLADE-----AEVHLKFSAKLHSEVE 301

  Fly   694 RPAHLKLKHFEFAGKMVGKCLFESA-----LGGTYRQLVRAR---FSRSFLAQLIGLRVHYKYFE 750
            :|.....::|:   |.:.||....|     |...|..:.:||   ..|....::...::..|...
Mouse   302 KPLMNFRENFK---KDMKKCDHHIADLRKQLASRYASVEKARKALTERQKDLEMKTQQLEIKLSN 363

  Fly   751 QDDPDLYLSKIKYILDTDLDATDTLELY------FVEEMYDSSSGQLSKTIELIPNGAKTRVTNA 809
            :.:.|:..::.|.....| |....::||      :.|||       ::.|:||    .:..|...
Mouse   364 KTEEDIKKARRKSTQAGD-DLMRCVDLYNQAQSKWFEEM-------VTTTLEL----ERLEVERV 416

  Fly   810 TKNQYLDALAQQRLC--NNVKDEVDSFLKGLNSIIP-DNLLSIFD 851
                   .:.:|.||  ..::.|.|.|  ..:::.| |.||...|
Mouse   417 -------EMIRQHLCQYTQLRHETDMF--NQSTVEPVDQLLRKVD 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 50/260 (19%)
HECTc 642..974 CDD:214523 45/227 (20%)
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763
WW_FCH_linker 109..201 CDD:374680
F-BAR_GAS7 214..446 CDD:153333 54/297 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.