DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4238 and Plekha5

DIOPT Version :9

Sequence 1:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_006506926.1 Gene:Plekha5 / 109135 MGIID:1923802 Length:1270 Species:Mus musculus


Alignment Length:324 Identity:71/324 - (21%)
Similarity:117/324 - (36%) Gaps:92/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 CLF-------ESALGG-----------TYRQLVRARFSRSFLAQLIGLRVHYKYFEQD---DPDL 756
            |||       |..||.           |....:..::  :|.|....:|.:  ||..|   :.:|
Mouse   199 CLFYYRDEKEEGILGSILLPSFQIAMLTAEDHINRKY--AFKAAHPNMRTY--YFCTDTGKEMEL 259

  Fly   757 YLSKIKYILDTDLDATDTLEL----YFVEEM-YDSSSGQLSKTIELIPNG---AKTRVTNATKNQ 813
            ::   |.:||..|..|:.::.    :.|::: .||:|   :|....|||.   .:..|.|..||:
Mouse   260 WM---KAMLDAALVQTEPVKRITFNFRVDKITTDSAS---TKETNNIPNHRVLIRPEVQNHQKNK 318

  Fly   814 YLDALAQQRLCNN-----VKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTG---------- 863
            .:..:.::|....     .||..|..|..:||:..::|||.::          :|          
Mouse   319 EISKIEEKRALEAERYGFQKDGQDRPLTKINSVKLNSLLSEYE----------SGPDCPPQNVHY 373

  Fly   864 ---EYSISDFKAHHIA----NGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQL------ 915
               ..:.||.||.:::    .|.|......||           ||..|::|.|....||      
Mouse   374 RPINVNSSDGKAVNVSLADVRGGSHPNAGPLA-----------TEADRVIQRTNSMQQLEQWIKV 427

  Fly   916 PPGGFQELNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEK----SLLLAISEGSEGFG 975
            ..|...|..|:..|:......|:|:........|...|.:..:..|    |:....|.|.|..|
Mouse   428 QKGRGLEEEPRGVISYQTLPRNMPSHRAQILARCPEGYRTLPRNSKTRPESICSVTSSGHEKTG 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 70/322 (22%)
HECTc 642..974 CDD:214523 70/321 (22%)
Plekha5XP_006506926.1 WW 13..42 CDD:366073
WW 59..88 CDD:366073
PH_PEPP1_2_3 165..268 CDD:270068 17/75 (23%)
Smc <623..>864 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.